KEGG   Vibrio sp. EJY3: VEJY3_16431Help
Entry
VEJY3_16431       CDS       T01683                                 

Definition
GGDEF family protein
Orthology
K13590  
diguanylate cyclase
Organism
vej  Vibrio sp. EJY3
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(138058..139071)
Genome map
AA seq 337 aa AA seqDB search
MTDEFKKSTANLKKAVPLMIKNYVAATPANYALWYTYVDNAIPDLNLEMDTVLKSYDVCP
PAATKNLYKRYVANKAETSLDDLRNNIEVLLNEISSSMNDTISDTSTFSDMVDKSVNKLE
KVQDNNVSIEEVMNAVHQFVEDAHEIRHSTKFLNSQLTNASEEISRLKTQLAEVQKDALF
DGLSNLYNRRAFDSDLAALVDANQSMSLIMLDIDHFKEFNDCYGHLFGDSVLKSIARRLQ
QSCRDGSCAYRFGGEEFALIVPNKSLRIARQYADTLRRMIEKLRVKDKRTGTQVHSITAS
FGVAEFEPGETAESLVSKADKQLYDAKMLGRNRVMPI
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgactgacgagtttaagaaatcaaccgctaacttaaaaaaagcggtgccactaatgatc
aaaaactacgtagcagcaactccagctaactacgcgctttggtatacctacgtggataac
gccattccagatctcaatctagagatggatacggtgttaaaaagctacgatgtttgtccg
ccagctgccacgaagaatctctataagcgttatgtggcaaataaagcagaaaccagtctt
gacgatctaagaaacaatatagaagtgttgttgaacgaaatatcaagttcaatgaatgat
acgatttcagatacctccacattttcagacatggtagacaagagcgtcaacaagctagaa
aaagttcaagataacaatgtgagcattgaggaagtcatgaacgccgtccatcagttcgta
gaggatgcgcatgagattcgtcattcaactaagtttttaaatagtcagctcaccaacgcc
agtgaagagatttctcgcctcaaaacccaactggcagaagtacaaaaagacgccctattt
gatgggctatccaacctctacaaccgtcgcgcttttgattcagatctcgccgcgttagtc
gatgcaaatcagtcgatgagtctgataatgcttgatatcgaccatttcaaagaatttaac
gattgttatggccaccttttcggtgacagcgttcttaaatcgattgctcgacgactgcaa
cagagctgtcgtgatggaagctgcgcttatcgttttggcggtgaagagtttgcgttaatt
gtaccgaacaaatcgctgcgtattgcacgtcaatatgctgatacgctgcgccgtatgatt
gaaaaactacgagtaaaagataaacgcacgggcactcaggttcacagcataacagcgtcg
tttggtgtggcagaatttgaacctggagagacagcggaatctctggtttccaaagcagat
aagcaactttatgatgccaagatgttaggtcgaaatcgagtcatgcctatctag

DBGET integrated database retrieval system