KEGG   Vibrio sp. EJY3: VEJY3_16431Help
Entry
VEJY3_16431       CDS       T01683                                 

Definition
(GenBank) GGDEF family protein
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
vej  Vibrio sp. EJY3
Brite
Enzymes [BR:vej01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     VEJY3_16431
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2:complement(138058..139071)
Genome map
AA seq 337 aa AA seqDB search
MTDEFKKSTANLKKAVPLMIKNYVAATPANYALWYTYVDNAIPDLNLEMDTVLKSYDVCP
PAATKNLYKRYVANKAETSLDDLRNNIEVLLNEISSSMNDTISDTSTFSDMVDKSVNKLE
KVQDNNVSIEEVMNAVHQFVEDAHEIRHSTKFLNSQLTNASEEISRLKTQLAEVQKDALF
DGLSNLYNRRAFDSDLAALVDANQSMSLIMLDIDHFKEFNDCYGHLFGDSVLKSIARRLQ
QSCRDGSCAYRFGGEEFALIVPNKSLRIARQYADTLRRMIEKLRVKDKRTGTQVHSITAS
FGVAEFEPGETAESLVSKADKQLYDAKMLGRNRVMPI
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgactgacgagtttaagaaatcaaccgctaacttaaaaaaagcggtgccactaatgatc
aaaaactacgtagcagcaactccagctaactacgcgctttggtatacctacgtggataac
gccattccagatctcaatctagagatggatacggtgttaaaaagctacgatgtttgtccg
ccagctgccacgaagaatctctataagcgttatgtggcaaataaagcagaaaccagtctt
gacgatctaagaaacaatatagaagtgttgttgaacgaaatatcaagttcaatgaatgat
acgatttcagatacctccacattttcagacatggtagacaagagcgtcaacaagctagaa
aaagttcaagataacaatgtgagcattgaggaagtcatgaacgccgtccatcagttcgta
gaggatgcgcatgagattcgtcattcaactaagtttttaaatagtcagctcaccaacgcc
agtgaagagatttctcgcctcaaaacccaactggcagaagtacaaaaagacgccctattt
gatgggctatccaacctctacaaccgtcgcgcttttgattcagatctcgccgcgttagtc
gatgcaaatcagtcgatgagtctgataatgcttgatatcgaccatttcaaagaatttaac
gattgttatggccaccttttcggtgacagcgttcttaaatcgattgctcgacgactgcaa
cagagctgtcgtgatggaagctgcgcttatcgttttggcggtgaagagtttgcgttaatt
gtaccgaacaaatcgctgcgtattgcacgtcaatatgctgatacgctgcgccgtatgatt
gaaaaactacgagtaaaagataaacgcacgggcactcaggttcacagcataacagcgtcg
tttggtgtggcagaatttgaacctggagagacagcggaatctctggtttccaaagcagat
aagcaactttatgatgccaagatgttaggtcgaaatcgagtcatgcctatctag

DBGET integrated database retrieval system