KEGG   Vibrio sp. EJY3: VEJY3_16736Help
Entry
VEJY3_16736       CDS       T01683                                 

Definition
pyrazinamidase/nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
vej  Vibrio sp. EJY3
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:vej00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(204456..205109)
Genome map
AA seq 217 aa AA seqDB search
MTVRVNYQTTAVFDVDPEKGFSELCPDELPVAGALEIVPELLKNHAKGRLKLVSRDLHPS
KAAWDAETPANMLEPVGLPNVDVKWNRHCVLGTTGVELLDGLPPVLEYDFQVNKGMDPDA
HPYGVFFHDVADTKTTGANEFLKCNDIDTLVVGGLALDFCVKKSVMQALDLGFKVVVNLA
STRAVLPDTLDDVIAEMKQNGALFVDCADDIIVEQFA
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgactgttcgagtaaactatcaaaccactgcggtattcgatgtggatcctgaaaaaggg
ttcagtgagctttgccctgacgaactacccgtagcaggcgcccttgaaatagtaccggaa
ctgcttaaaaaccacgcaaaaggtcgtttaaaactggtgagtcgcgacttacacccgtct
aaagccgcttgggacgcagaaacgccagccaatatgttagagcctgttggtttgccaaac
gtcgacgtgaaatggaatcgtcactgcgtactcggcacgaccggtgttgaactgttagac
ggattgccgcctgttctggagtatgatttccaagtcaataaaggcatggatccagacgca
catccatacggcgttttctttcatgacgtagctgataccaaaacgactggtgcgaatgag
ttcctgaaatgtaacgacatcgatacgcttgttgtcggtggcttagcgctcgatttctgc
gtaaaaaaatcggtgatgcaggcattagatctcgggtttaaagtcgttgtgaatcttgct
tcgacacgcgcagtattgccagatacccttgatgatgtgattgctgaaatgaaacaaaac
ggcgcgttatttgttgactgtgctgatgacatcattgtcgagcagtttgcataa

DBGET integrated database retrieval system