KEGG   Vibrio sp. EJY3: VEJY3_17251Help
Entry
VEJY3_17251       CDS       T01683                                 

Definition
6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
vej  Vibrio sp. EJY3
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:vej00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:322085..323527
Genome map
AA seq 480 aa AA seqDB search
MSNNVFPEDFMWGGATAANQFEGAWNVDGKGPSTSDMFSGGTHTVARRITRTIEEGVHYP
SHEAIDFYHRFREDIALFAEMGFKTFRFSINWTRIFPTGMELEPNEEGLKFYEDVIDELK
KYDIEPLVTISHYELPFGLTQEYNGWAGREVVDCYTRYAETLFKRFNGKVKYWLTFNEIN
IGTMPIGNYLGLGILNDGTEDFISQVDYPQLRFQALHHQFVASAKAVKLAHEINPENKVG
CMICFLTTYPFTCNPEDIVLAQEHMKMHNYFCGDIQVRGQYPYYAKRYFEENNIEVKMEA
GDAEILSEGTVDYYTLSYYMSNCVSADSSKETTSGNLMGGVKNPYLQASDWGWQIDPIGL
RYTLNEIYARYEIPLMVVENGLGAFDKVEEDGSINDSYRIDYLKAHIEQMSEAVKDGVEL
WGYTPWGCIDLVSASTGEMEKRYGFIYVDKDNKGEGTLDRKKKASFDWYKKVIASNGTEL
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgagcaataacgtttttccagaagattttatgtggggtggtgcaaccgcagcaaaccaa
tttgaaggggcatggaatgtagacggtaaaggaccaagtacaagtgatatgtttagtggt
gggactcataccgttgctcgccgaatcactcgcactattgaagaaggtgttcactatcct
tcacatgaagccatcgacttttatcatcgcttcagagaagatattgccttgttcgctgaa
atgggctttaaaaccttccgtttttcgattaactggacccgaatttttccaaccggcatg
gagctggaacccaatgaagagggtttgaagttctatgaagacgttattgacgagcttaaa
aaatacgatattgagccattagttacgatttcacattacgaactgccgttcggtctgact
caagaatacaacggctgggctggaagagaagttgtcgattgctacacacgctacgcggaa
acactgtttaagcgcttcaatggcaaagtgaaatactggttaactttcaacgaaatcaac
atcggtacgatgcctatcggaaactacttaggcttgggaatccttaacgacggtaccgaa
gactttattagtcaggttgactacccgcagctacgttttcaggctctgcatcaccagttt
gtcgccagtgcaaaagcggtaaaactggctcatgagatcaatcctgagaataaggttggt
tgtatgatctgcttcctgaccacttacccgttcacgtgtaatcctgaagatatcgtactt
gctcaagaacatatgaaaatgcacaactacttctgcggtgatattcaggtgcgcggtcaa
tatccgtactacgcaaaacgctactttgaagaaaataacatcgaagtgaaaatggaagcg
ggcgatgcagagattctttctgaaggaaccgtcgactactacacactaagctactacatg
tcgaactgtgtttccgcggattcaagtaaggaaacgacttctggtaacctgatgggcggt
gttaagaacccatatttgcaagcatcagactggggttggcaaatagacccaattggtctg
cgttacacactgaatgaaatttatgctcgttatgagattcctttgatggtggttgaaaac
ggtttgggtgcattcgataaagtcgaagaagatggctcaatcaacgatagctaccgtatt
gattacctgaaagcgcatattgagcaaatgagtgaggcagtaaaagacggtgttgaattg
tggggttacacaccttggggttgtatcgacttggtgagcgcatccactggtgagatggaa
aaacgctacggctttatttatgtcgataaagacaacaagggtgaaggtaccttagatcgt
aaaaagaaagcctctttcgactggtacaagaaagtcatcgcttcaaatggtacagagctt
taa

DBGET integrated database retrieval system