KEGG   Vibrio sp. EJY3: VEJY3_17766Help
Entry
VEJY3_17766       CDS       T01683                                 

Gene name
folE
Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
vej  Vibrio sp. EJY3
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:vej00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:431990..432643
Genome map
AA seq 217 aa AA seqDB search
MSGLSESAKLVKEALEQRGLETPMRPNNVSREEKKEKIEYHMREILGLLQLDLTDDSLEE
TPHRIAKMYVDEIFSGLDYSNFPKITVIENKMNVSEMVRVKDITVTSTCEHHLVTIDGKA
AVAYIPRGKIIGLSKINRIVRFFAQRPQVQERMTQQILIALQTLLESDDVAVTIDATHYC
VKSRGVMDATSETTTTALGGIFKSNPATRAEFLHGLR
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggtcttagcgagtcagcgaagttagtaaaagaagcgctagagcaacgtggatta
gaaacgccaatgcgtcctaacaacgtaagccgtgaagagaaaaaggaaaagatcgagtac
catatgcgtgagatcttaggcctccttcagcttgaccttacggatgatagcctagaagaa
acaccgcatcgcattgcaaaaatgtacgtggacgaaattttctctggtctggattattcg
aacttcccgaaaatcactgttatcgaaaataagatgaacgtgagtgaaatggttcgtgtg
aaagacatcactgtgaccagcacttgtgagcaccaccttgtgacaatagatggtaaagcc
gctgtagcgtatattcctcgtggcaaaatcattggcctgtcgaagattaaccgaattgta
cgcttctttgctcagcgtccacaggttcaggaacgtatgacacagcagatccttatcgcg
ttacaaacgcttcttgagtctgacgatgtggctgtgacgattgacgcgacgcactactgc
gtgaaatcacgtggtgttatggacgcaaccagtgaaacaacgaccactgcgttgggaggc
atcttcaagagcaacccagcgacacgtgccgaatttctgcacggtttacgataa

DBGET integrated database retrieval system