KEGG   Vibrio sp. EJY3: VEJY3_18446Help
Entry
VEJY3_18446       CDS       T01683                                 

Definition
hypothetical protein
Orthology
K08738  
cytochrome c
Organism
vej  Vibrio sp. EJY3
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:vej00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    VEJY3_18446
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    VEJY3_18446
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(586668..587327)
Genome map
AA seq 219 aa AA seqDB search
MKSHNLRERVFPLSLSLLSLVSGLTFANTELIEVGEQQAMVCKACHQFEPNGVTVVGPPL
WGLAERSIASFAGFNYSEGIKQHQGKWDAEKLDAFLASPTEFAPGTNMVFPGVKDPGARA
AIIAWLATKNSSPPDWVTPSSGMEVKSAGDGILTPGENMELVAAICSACHSLHMVAQQGL
SRKRWDKMLDWMIEEQGMEELDGDDREAVLDYLSVYYGQ
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaagtcataaccttagagagcgggtcttcccgctctctctatcactattaagcctt
gttagtgggcttacctttgcaaacacagagttaattgaagtgggcgaacaacaagcaatg
gtatgtaaagcttgtcaccaatttgaacccaatggcgtcactgtggttggtccgccactg
tgggggctggcagaacgttctattgctagttttgcgggctttaattacagcgagggaata
aaacagcatcaaggcaaatgggatgctgaaaagcttgatgcatttttagcgtcccccact
gagttcgcaccaggcaccaacatggtgtttccgggagtgaaagacccaggggctcgagcc
gccatcatcgcgtggcttgcgactaagaactcctcacctcctgactgggtcaccccttcg
tccggaatggaagtaaaatcagcgggggatggaatcttaacaccgggagaaaacatggaa
ctggttgcggcaatatgctctgcttgtcattctttacatatggtcgctcagcaaggttta
agcagaaagcgttgggataaaatgctcgactggatgatagaagagcaaggtatggaagaa
ctcgatggcgatgatcgtgaagctgttcttgattatttatctgtctactatggccaataa

DBGET integrated database retrieval system