KEGG   Vibrio sp. EJY3: VEJY3_18966Help
Entry
VEJY3_18966       CDS       T01683                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
vej  Vibrio sp. EJY3
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:vej00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    VEJY3_18966
Enzymes [BR:vej01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     VEJY3_18966
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:703127..704047
Genome map
AA seq 306 aa AA seqDB search
MNKLVVLGSVNADHVLQVPSFPRPGETLHGRNYQVIPGGKGANQAVAAARLNSDIGFIAC
VGDDSFGINIRENFKMDGIDISAVKMQPNCPTGIAMIQVADSGENSICISAEANAKLTAE
AIEPDLERIRRAEYLLMQLETPICAIEKAARVAKYAKTNVILNPAPARELSDELLACIDV
ITPNETEAEVLTGVTVTDNDSAQEAANILHSKGIEIVMITLGAKGVWLSQNGRGEIIPGF
RVDATDTTAAGDTFNGAFVTGLLEGLSLESAIKFAHAAAAISVTRFGAQTSIPTREEVDA
FLAENQ
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgaataagttagtagtgttaggtagtgtaaacgctgaccatgttcttcaagtgccttct
tttcctcgcccaggcgagacgcttcatggtcgcaactaccaagttattcctggcggtaaa
ggagcaaatcaagccgttgccgcagcacgtctgaattctgatattggttttattgcttgt
gttggtgatgattcattcgggatcaatattcgcgagaattttaagatggatggcatcgac
attagtgcggtgaagatgcagccaaactgtccaactggtattgcgatgattcaggtagca
gatagtggtgagaacagtatttgtatttcggcagaagcgaacgctaagctgaccgctgag
gctattgagccagatctggagcgcatacgccgcgctgaatacttgttgatgcaacttgag
acaccgatatgtgccatcgagaaagcggcgcgtgtagcaaaatatgcaaaaacgaacgtg
attcttaacccagcacctgcgcgtgaattatcggacgaattattagcgtgtatcgatgtc
atcactccaaacgaaaccgaagcagaagtcctgactggcgtgacagtgacggataacgat
agtgctcaggaagcggccaacatcctgcatagtaaaggcattgaaatcgtgatgattacc
ctaggagcgaaaggcgtttggttaagtcagaatggtcgtggcgagattatccctggtttc
cgcgttgacgctaccgataccacggcagcaggcgacacgtttaatggggcattcgtcact
ggtttattggaaggtttgtctttagaatcagcaattaagtttgcacacgcagcggcagcc
atttcagttacgcgctttggtgcacagacgtctatcccaactcgtgaagaggtggacgca
ttcttagctgaaaaccaataa

DBGET integrated database retrieval system