KEGG   Vibrio sp. EJY3: VEJY3_19911Help
Entry
VEJY3_19911       CDS       T01683                                 

Definition
arylesterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
vej  Vibrio sp. EJY3
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:vej00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    VEJY3_19911
Enzymes [BR:vej01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     VEJY3_19911
   3.1.2  Thioester hydrolases
    3.1.2.-  
     VEJY3_19911
Lipid biosynthesis proteins [BR:vej01004]
 Fatty acid synthase
  Component type
   VEJY3_19911
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:917038..917640
Genome map
AA seq 200 aa AA seqDB search
MIRLLSLVLFFCFSVTAFANEKLLVLGDSLSAGYNMPIEKSWPSLLPDVLLEHGQTVTVI
NGSISGDTTGNGLARLPQLLEQHSPSIVLIELGANDGLRGFPPKLITSNLSKMITMIKDF
GAEVIMMQIRVPPNYGKRYSDMFYDIYPKLAEHQQVQLMPFFLEHLVTKPDWMMNDGLHP
KPEAQPWIADFVAQELIKHL
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgattcgattactttccttagttctctttttttgtttttctgttacggcgttcgctaac
gaaaaactgcttgttttaggtgacagcctaagtgctggctacaatatgccgattgagaag
agttggcctagcttactccctgacgttcttttagaacatggtcaaactgtaacagttatt
aatggcagcatctcaggtgataccactggcaatggtctggcccgccttcctcaacttctt
gaacaacattcaccatccattgttctcattgaactgggtgcaaatgatggccttcgaggt
ttcccgcctaagcttattacgtcaaatctctccaaaatgattactatgatcaaagatttt
ggtgcggaagtcatcatgatgcaaattcgtgtgccgccaaattacggcaaacgttacagt
gacatgttttacgatatctatccaaaattagcagaacatcagcaagtgcaattaatgcct
ttctttctggagcatctggttacgaagccagattggatgatgaatgacggccttcaccct
aagccggaagcgcagccatggatcgctgatttcgttgctcaagaattgattaaacatttg
tag

DBGET integrated database retrieval system