KEGG   Vibrio sp. EJY3: VEJY3_20376Help
Entry
VEJY3_20376       CDS       T01683                                 

Definition
acetyl-CoA synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
vej  Vibrio sp. EJY3
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:vej01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:vej00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:vej00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:vej00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:vej00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:1021834..1023570
Genome map
AA seq 578 aa AA seqDB search
MVKTIFHQTLADNANLQLDPRNAVLSPPLLKGLSEGGLNIGFEALDRHLIQPEHNKLAIR
WISKDNEVIDFSYRDLSEQTNRFADLLSTLDLPRGSRVFSLAGRRPELYIAALGTLKAGC
VFTPLFSAFGPEPIRSRMEIGSANVVITTRSLYRKKLKGWWRELDHIKAVLLIDGGADGE
PGCYNYHEMMADTNPERPCESTQPEDMALLHFTSGTTGKPKGVIHVHQAVQHHINSAFYA
LDLKPDDIYWCTADPGWVTGTTYGIIAPLCLGVSMIIDEAEFDAERWYQILQDQHVTVWY
TAPTAIRMLMKIGEALPRQFDLSRLRFMASVGEPLNPEAVEWGEKVFGMPFHDNWWQTET
GGIMIANVPSRPVKPGSMGKPLPDIEAGIVNQNDDGSLREETEPMQVGELALKSGWPSMF
RGYLNQEEKYQSCFKGDWYLSGDLAMKDADGYFWFVGRKDDLIKSSGHLIGPFEVESVLM
EHPAVAEAGVIGVPDPVAGQIVKAFVALKPNVTADEELQQSLLGLARKRLGAAVAPKEIV
FRNNLPKTRSGKIMRRLLKARELGLPEGDISTLESDEQ
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atggttaaaacaatttttcaccaaacgctagcggacaatgccaacctgcaattagatcca
cgcaacgctgtgctctctcctcctttactgaaaggtttgagcgaaggcggtttaaacata
ggtttcgaggcattagatagacaccttatccaaccggaacataataaactggcgattcgt
tggatcagtaaagacaacgaggtcattgacttcagttaccgcgacctgagcgagcaaact
aaccgctttgcagatctactatctacactcgatttaccgcgtggtagcagagtgttcagc
cttgcgggtcgcagaccggaactctacattgcggcgttaggaaccctcaaagccggttgt
gtgtttactccactcttttcagcatttggccccgagcctatccgctccagaatggagatt
ggttcggcgaatgtcgtcattacaactcgcagcttataccggaaaaaactcaaaggctgg
tggcgggaattggatcatattaaagcggtattgctgattgatggtggcgctgatggggaa
cccggatgctacaactatcacgagatgatggctgatacgaaccctgaacgcccatgcgaa
tctacacagcctgaagatatggcgctacttcactttaccagcggcaccactggaaaacct
aagggtgtcatccatgttcatcaggccgtacagcatcatattaattcagccttttacgcg
ttagatctaaaacctgatgacatctattggtgtactgccgatccaggttgggtaacgggc
accacttacggcattatcgccccactctgtttgggcgtaagcatgattattgacgaagcc
gagtttgatgctgaacgttggtatcagatcttacaggatcaacatgtcaccgtttggtat
accgcccctactgcgattcgtatgttgatgaaaataggtgaagcgctgcctaggcaattc
gatttgtctcgtttacgttttatggccagcgttggcgaaccactgaatcctgaagcggtt
gaatggggtgaaaaagtctttggtatgccatttcatgacaactggtggcagacggaaact
ggcgggatcatgattgccaatgttccttcgaggccggtcaaaccgggttcaatgggcaaa
ccacttcccgatattgaagctggcattgtgaatcaaaacgatgacggttccctacgtgaa
gaaacagagccaatgcaagtcggagagctcgcgctcaaatccggctggccttctatgttt
cgcggctatttaaatcaagaagaaaaatatcagtcctgctttaaaggcgattggtacctc
agtggcgatctggcgatgaaagatgcagacggctatttctggttcgtcgggcgtaaagat
gaccttattaaatcttctggccacttgattggacctttcgaggtagaaagtgtcctcatg
gagcacccagcagtcgccgaggctggtgtgattggcgtacccgatcccgttgcaggtcaa
atcgtcaaagcctttgtcgcacttaaaccaaacgtgaccgctgacgaagaacttcagcaa
tcgctgcttggtttagctcgcaaacgccttggcgccgcagtcgcaccgaaagaaatcgtc
tttcgtaacaacctgccaaaaacacgcagtggcaaaatcatgcgtcgcttacttaaagca
cgagagctgggcttgcctgaaggtgatatttcgactttggagagtgatgaacaatga

DBGET integrated database retrieval system