KEGG   Vibrio sp. EJY3: VEJY3_21461Help
Entry
VEJY3_21461       CDS       T01683                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
vej  Vibrio sp. EJY3
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:vej00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:vej00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:vej00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(1273660..1275777)
Genome map
AA seq 705 aa AA seqDB search
MKEKKLVELSGTESQLIIEVGDFAEILHWGKKLSGSLENFRSALHRPVPHGRLDKDVAMT
TLPELGRGVFSSPGLEGHRNGQDWAPVFFLKSIQQCDNQISLTSEDERAGLQLLTEICLD
EFDVVKTRHTLTNLKSGQYFVNRFANSMPLPVRVNELMTFHGRWAREFQTQRQPLLHNGY
QQENRRGRTSHEHYPAMVAGTSNFSETHGDVWGFHFAWSGNHRLRADVKTDGRRMMQAEV
IYFPGEVALEKGESIATPWLYASYSENGLNEMSHQFHSHVRHSIIAEDFQKKLRPVHLNT
WEGIYFDHDPEYIMEMASQAAEMGVERFIIDDGWFRGRDDDTAALGDWFLDERKYPNGLE
PVVDHVNALGMEFGLWFEPEMINKDSDLYREHPDWLLAVDGYDQPTGRHQHVIDLQNDDA
FNFLYERLDHFLSTYNIRYIKWDMNREIVQPAHDGVASGRKQTERYYQLVDKVRAKFPHV
SIESCAGGGGRIDYEILKRTDRFWPSDNNDALERQGIQRGMSYFFPPEVMGSHIGSDKCH
CTRRRHSIEFRGLTALFGHMGIELDPVKEDSDEKANFARYVALHKQLRDLLHTGKMWRTP
TDDSSHQIMSVVSEDQSEAVVMVAQLDMPTHSLSGNLRILGLDDSATYRIYVLDAPANYN
DIVVFQPPWTEAGCELSGEWCKEVGLSMPLLDPETAMLIKVEKIN
NT seq 2118 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaaaaaaagttagttgagttaagcggaacggagtcccaacttattattgaggtt
ggtgactttgcagaaattctacactggggtaagaaactaagtggcagtctagaaaacttt
cgctccgctttgcatcgtcctgtacctcatggacgcttagataaagacgtagccatgaca
acgttacctgaacttggtcgtggtgtattcagcagcccgggtttagaaggtcaccgcaat
ggtcaggactgggcaccagtattcttcttaaaaagtattcaacaatgtgataaccaaatc
agtcttacgagcgaagatgaacgtgctggtttgcaactgttgacggaaatttgcttagat
gaatttgatgtggttaaaactcgtcataccttaactaacctaaagtccgggcaatatttc
gtcaatcgctttgctaactcaatgccattacctgtaagagttaatgagctgatgacgttc
cacggccgttgggcaagagaattccaaacacaacgtcagccactacttcataacggatat
cagcaagagaacagacgcggcagaacttcccatgaacactatcctgcaatggttgctggt
acgtctaacttcagtgagacccacggcgatgtttggggattccactttgcttggagcggt
aaccatcgattacgtgccgatgtaaaaacggatggtcgtcgtatgatgcaagctgaagtg
atctattttcctggagaagtcgcgctggaaaaaggggaaagcattgctacgccatggttg
tatgcaagttacagtgagaacggactcaatgagatgagtcatcaattccattcgcatgta
agacactcgatcatcgcggaagactttcagaagaagttacgtccggtgcatttgaataca
tgggaagggatctatttcgaccacgatcctgaatacatcatggaaatggcctcgcaagca
gcagaaatgggagtggagcgttttatcattgatgacggatggttcagaggtcgcgatgat
gacacagcggcattaggggattggttcttggatgagcgcaaatacccaaatggccttgag
ccagttgtcgatcacgttaatgcattaggcatggaatttggtttgtggtttgagccagaa
atgatcaataaagactcagatttataccgcgaacatccggattggctacttgctgtcgat
ggttatgaccaaccgacaggcagacatcaacatgttattgatttgcaaaacgatgatgcg
ttcaacttcttatacgaacgattggatcatttcttaagcacctacaatattcgctacatc
aagtgggatatgaaccgagaaatcgttcagccggcgcatgatggtgtggcatctggacgc
aagcagacagagcgttactaccagttggtcgataaggtaagagccaaattccctcacgtc
agtattgagtcctgcgcgggcggcggtggccgtattgattacgaaattttgaaacgaact
gaccgcttctggccctcggataataacgatgcgttagaaaggcaagggatccagcgtggt
atgagttacttcttcccgccagaagtgatgggcagccatattggatctgataaatgtcat
tgtactcgccgccgtcatagtattgagttccgtggattgacggcactgtttggccatatg
ggaatagagcttgatccggtgaaagaagatagtgatgaaaaagcgaactttgctcgttat
gtcgcgctacacaagcagttacgtgatctgttacatactgggaaaatgtggcgtaccccg
accgatgatagctcgcatcagataatgtcagtcgtatcggaagatcaatccgaagcggtt
gtgatggttgctcaattggatatgccaacacattcactaagtggcaacctgagaatatta
ggcttggatgattcagcaacttaccgtatttatgttttggacgcgccggcaaattacaac
gacattgtcgtattccagccgccttggactgaagctggttgcgaactcagtggtgagtgg
tgcaaagaggttggtttaagcatgccgctactcgatccagaaactgcgatgttaattaaa
gtcgagaagataaattga

DBGET integrated database retrieval system