KEGG   Vibrio sp. EJY3: VEJY3_21716Help
Entry
VEJY3_21716       CDS       T01683                                 

Gene name
glk
Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
vej  Vibrio sp. EJY3
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:vej00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VEJY3_21716 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VEJY3_21716 (glk)
   00052 Galactose metabolism
    VEJY3_21716 (glk)
   00500 Starch and sucrose metabolism
    VEJY3_21716 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    VEJY3_21716 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    VEJY3_21716 (glk)
   00524 Butirosin and neomycin biosynthesis
    VEJY3_21716 (glk)
Enzymes [BR:vej01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     VEJY3_21716 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(1335921..1336892)
Genome map
AA seq 323 aa AA seqDB search
MSEQYALVGDIGGTNARLALCELATGTISDIVTYPAAEYETLEIVIRKYLERHDTPILSA
CIAIACPVTGDWVSMTNHHWEFSIQELKSQLNLQVLEVINDFTAVSFAIPSLNLEDRVQI
GGGEPISNKPIAVYGAGTGLGVAQLIHGGNLWHSVPGEGGHVDLAACTPEEDDLIVYLRN
KFGRVSAERCLSGQGIRNIYDFVVSHRGAEPEDYTPAKITEKALKSECKDCERALYLFCI
LMGRFGGNLALTNGSFGGVYIAGGIVPKVQDLFIKSGFRVAFEDKGRFKEYLQSIPVFLI
THSEPGLLGAGTYIRQSLNISIN
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaacagtatgccttggtaggggatatcgggggaaccaacgcgcgtttagctctt
tgtgagttagcgacagggacgatcagcgatatcgtgacttaccctgctgccgaatatgaa
acgctggaaatcgtgattcgcaaataccttgagcgtcatgacactccaatcttatcggcc
tgtattgcgattgcttgtccggtaaccggagattgggtttccatgactaaccaccactgg
gagttctctattcaggaattaaaatcccaactcaaccttcaggttttggaagtcattaac
gatttcacagcggtttcctttgctatcccaagcttaaatcttgaggacagagttcaaatt
ggtggtggcgagccaatctcaaataaaccaattgcggtttacggagcggggacggggctt
ggtgttgctcagttaatccatggtggaaacctttggcacagtgtaccgggagaaggtgga
catgttgacttggctgcttgtactccagaagaagacgatttgatcgtttacctacgtaac
aagttcggtcgtgtgtctgcggaacgctgtttgtctggccaaggtatccgaaacatatac
gactttgttgtgtcacaccgtggtgccgagcctgaagattacactccggcaaagattaca
gagaaagcacttaaatctgaatgcaaggattgtgagcgcgcactctatctgttttgcatt
ttgatggggcgttttggcggtaatcttgctctgaccaatggttcatttggtggtgtgtat
attgctggtggtattgttcctaaagttcaagacctattcatcaagtctggctttcgagtg
gcttttgaagataaaggccgttttaaagagtaccttcaatctatccctgtattcttgatc
actcattccgaacctggcctgctgggcgcaggcacctacatcagacagtcattaaatatc
tctataaattaa

DBGET integrated database retrieval system