KEGG   Vibrio sp. EJY3: VEJY3_22366Help
Entry
VEJY3_22366       CDS       T01683                                 

Definition
glutathione-independent formaldehyde dehydrogenase
Orthology
K00148  
glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
vej  Vibrio sp. EJY3
Pathway
Chloroalkane and chloroalkene degradation
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:vej01200]
Metabolism; Energy metabolism; Methane metabolism [PATH:vej00680]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:vej00625]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:1481257..1482459
Genome map
AA seq 400 aa AA seqDB search
MSYEKSNRAVVYKGPGKVAVESIPYPELALGNRKCEHGVILKVLTTNICGSDQHMVRGRT
TAEEGLVLGHEITGIILEKGRDVEFVDVGDIVSVPFNIACGRCRNCKSGMTGICLNVNPA
RPGAAYGYVDMGGWVGGQSEYVMIPYADFNLLKFPDPDQAREKIKDLTLLSDIFPTGFHG
CVTAGVGPGSTVYIAGAGPVGLAAAVSAQLLGAACVIVGDMIPDRLEQARSFGCETIDLR
EDGSMEDKIEAILNEREVDCFVDCVGFEAHGCGCGGHTQEAPATVLNSAMQVTRAGGSIG
IPGLYVTDDPGAKDEAAKEGALSMRFGLGWAKSHSFHTGQCPVMKYHRGLMQSILFDKVK
IADAVNVQMISLDQAPQGYADFDGGAAKKFVIDPHGEFSK
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgtcctacgaaaaatcaaaccgcgccgttgtttacaaaggcccgggcaaagttgctgtc
gagtcaattccatacccagaactcgcattaggcaatcgtaagtgtgagcacggcgtaatc
cttaaagtgctgacgaccaatatctgtggcagcgaccaacatatggtacgtggacgtaca
accgctgaagaaggcttagtacttggtcacgaaatcacgggcatcattttagaaaaaggc
cgcgatgtcgagttcgttgatgttggcgatatcgtttcagtaccgtttaacattgcttgt
ggccgatgccgcaactgtaaatcaggcatgactggtatctgcctcaacgtaaaccctgct
cgtcctggtgcggcatacggttatgttgatatgggcggctgggttggcggccaatcggag
tacgtaatgataccgtacgctgactttaacttacttaagttcccagatccggatcaggca
cgagagaaaattaaggatttaacactactgtctgatatcttccctacgggtttccatggc
tgtgtaaccgcaggtgttggtcctggttctaccgtttatatcgctggtgcaggtcctgtg
ggtctggcagcagcagtatcggctcaactacttggcgccgcttgtgtcatcgttggagac
atgatcccagatcgtctagaacaagcacgtagttttggttgcgaaaccattgacctacgt
gaagacggcagcatggaagataaaattgaagcaattctgaatgagcgtgaagttgattgt
tttgttgactgtgttggtttcgaagcgcacggatgtggctgtggtggtcacactcaagaa
gcaccagcaacagtactgaactctgcgatgcaagtaacgcgtgccggtggttcgattggt
attcctggtctttacgttacagacgatccgggtgcgaaagacgaagctgcgaaagaaggt
gcactgagcatgcgctttggtcttggctgggcgaaatcacattctttccatactggccaa
tgcccggtaatgaaatatcaccgtggtctgatgcaatctattttgttcgacaaagttaaa
attgctgacgccgtaaacgtacaaatgatttcactcgatcaagcacctcaaggttacgcc
gactttgatggtggtgcagctaagaaatttgttattgacccgcacggtgaatttagcaag
taa

DBGET integrated database retrieval system