KEGG   Vibrio sp. EJY3: VEJY3_22581Help
Entry
VEJY3_22581       CDS       T01683                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
vej  Vibrio sp. EJY3
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:vej00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    VEJY3_22581
  Lipid metabolism
   00561 Glycerolipid metabolism
    VEJY3_22581
   00600 Sphingolipid metabolism
    VEJY3_22581
Enzymes [BR:vej01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     VEJY3_22581
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(1525654..1527774)
Genome map
AA seq 706 aa AA seqDB search
MTDKTLIELAGKETQLIVELGEYAEILHWGQKVNGDLEGYRVTLQRPVPYGRLDKDVSMT
LNPELGRGVFSSPGVEGHRDGQDWAPVFVITRIEQSKNCIAIESEDTIAGLRLNTILQMD
EHDVVKTRHTLTNIKAGTYHVNRLANTLPLPARANELLTYYGRWVHEFQTVRQPLTQGGY
QQENRRGRTSHEHYPAFVAGTAHFDEMNGDVWGFHLAWSGNHRLRADVKADGRRYMQAEV
IYLPGEVALEEGENVTTPWLYASHSSAGLNGMSHHFHSHVRDAILPRNFSDKPRPIHLNT
WEGIYFDHDPQYIMSMATQSAEMGVERFIIDDGWFKGRNGDKAGLGDWFLCESKYPHGLK
PIVDHVNVLGMEFGLWFEPEMINKDSDLYRTHPDWLLAVDGYDQPTGRNQYVINLQNDDA
FNFLFERLDHFLSTYNIAYIKWDMNREVVQPGHLGRAAAHNQTRRYYELVDKVREKHPQV
EIESCAAGGGRIDYEVLKRTHRFWASDNNDALERQTIQRGMSYFFPPEVMGSHIGASHCH
STRRRHSIEFRGLTALFGHMGIELDPVKEELQEKQGFERYIRLHKVLRPLLHSGRTWRVP
TDDKAHQIHAVVSEDQSEAVVMIAQLAMPTNSLSGHLRVPGLDPEGIYRVSVLDKPSNYD
DIVNYQPPWTESDWELSGDWCAEVGLTMPILDAETAMLVKFERVNE
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atgacggacaaaacgctgattgagctagcaggtaaagagactcaactgatcgtagagttg
ggtgagtatgcggagatcctgcattggggacagaaagtaaatggtgacctagaaggttat
cgtgtcactttacaacgtccggtcccttatgggcgtttagacaaagacgtatccatgact
ctgaatcctgagcttggtcgcggagtgttcagtagccctggagtggaaggccatcgcgat
gggcaggattgggcacccgtatttgttattactcgaatcgaacagagtaaaaactgcatt
gctatcgagagtgaagacactattgctggcctgcgcttaaataccattttgcagatggat
gagcatgatgtggtcaagacccgtcacacgctaaccaacatcaaagcggggacgtatcat
gtcaatcgtcttgctaatacacttccgttgccagcaagagcaaatgagttgttaacgtat
tacgggcgttgggtacatgagttccagactgtccgtcaacctttaactcagggtggttac
caacaagaaaatcgccgcggtcgtacctctcatgagcattaccctgcatttgttgctggt
acggctcactttgatgaaatgaatggtgacgtatggggattccaccttgcctggagtgga
aaccacagattgcgcgcggatgtgaaagcggatggacgccgctacatgcaggcagaagtg
atttatctaccgggtgaagtcgcgctagaagaaggtgaaaatgtgactacgccttggttg
tacgcaagccacagtagtgcaggtttgaatggcatgagccatcacttccattctcatgtc
cgcgatgcaattttgcctcgcaactttagcgacaaaccgcgtccgattcacttgaatacc
tgggaaggcatttacttcgatcatgatccgcaatacatcatgtcgatggccactcaatcg
gcagaaatgggggtagagcgattcattattgacgatggctggttcaaaggccgcaatggc
gacaaagcagggttaggggattggttcttatgtgaatccaaatatccacatggtttgaaa
ccaattgttgaccacgtaaatgtactgggtatggaatttggtttgtggttcgagccagaa
atgatcaacaaagattctgacttgtaccgcacgcatccagactggttacttgcagtagat
ggatacgatcagccgacaggtcgcaaccagtatgtgattaacctgcaaaatgatgatgcc
tttaacttcttgttcgaaagattggatcacttcctgtcaacttacaacattgcttatatc
aagtgggatatgaaccgtgaagttgttcagcctggtcaccttggtcgagcggcagcgcac
aatcaaactcgacgctactatgagttagtggataaagtacgtgaaaaacatccacaagtt
gagatcgaatcttgtgcggctggtggcggccgtattgattatgaagtactaaagcgtacc
catcggttctgggcttcagacaacaatgacgcgcttgaacgtcaaaccattcaacggggt
atgagctacttcttcccacctgaagtgatgggaagccatatcggagccagtcattgtcac
agtacgcgtcgtcgtcacagtattgaatttcgcgggctaaccgctctgtttggtcacatg
ggcatcgagctcgatccagtgaaagaagaactacaagaaaagcaggggtttgagcgttac
atcaggctacacaaagtattgcgtccgttgctacacagtggcagaacatggcgagtacca
acggatgataaagcacatcaaatccatgcggttgtttcagaggatcaatccgaggccgtg
gtaatgatcgctcagcttgctatgccgaccaattcactcagtggccatttacgagttcct
gggttggatcctgaggggatatatcgcgtctctgtgttagataagccttcgaattacgat
gatatcgttaattatcagcctccatggacagagtctgattgggaactctccggtgattgg
tgtgccgaagtgggattaaccatgcctattttagatgctgaaacggcgatgttggtgaag
tttgaacgcgtaaacgaataa

DBGET integrated database retrieval system