KEGG   Vibrio sp. EJY3: VEJY3_23631Help
Entry
VEJY3_23631       CDS       T01683                                 

Definition
hypothetical protein
Orthology
K07107  
acyl-CoA thioester hydrolase [EC:3.1.2.-]
Organism
vej  Vibrio sp. EJY3
Brite
Enzymes [BR:vej01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.-  
     VEJY3_23631
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:1771971..1772423
Genome map
AA seq 150 aa AA seqDB search
MDTLLKDFPVVTEIRVAWGEMDALQHVNNVVYFRYFETARLDYFEAINLLVDLQTSQISP
VLSETQCRYKLPVTYPDTLLIGARVIDMQGDRMTMEYQVFSKKWGKVVTVATATGVMFDF
KNNTKTEIPDNVRKSILELEATVGNTHHLE
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atggacacactactaaaagacttccccgtcgttactgagatcagagtagcttggggagaa
atggatgccttgcaacacgtcaacaacgtcgtctactttcgttacttcgaaaccgcacgt
ctggactattttgaagcgattaatttgctcgtcgacctgcaaacctcgcaaattagccct
gttctgagtgagactcagtgtcgttataaattgccagtgacttacccggacacgcttctg
attggcgctcgagtgatcgacatgcaaggcgatcgcatgacaatggaatatcaggtgttt
agcaaaaagtggggaaaagtggtcaccgtcgcgacggcaacgggtgtgatgtttgatttt
aaaaataacactaagactgagattccagacaacgtccgcaagtcgattctggaactggaa
gcgactgtgggcaacactcaccacctggagtaa

DBGET integrated database retrieval system