KEGG   Vibrio sp. EJY3: VEJY3_23706Help
Entry
VEJY3_23706       CDS       T01683                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
vej  Vibrio sp. EJY3
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:vej00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(1789626..1791806)
Genome map
AA seq 726 aa AA seqDB search
MKELTALKKVAEMARLADSYVSAWGDEAKVSDETLRRLLASLGYDTSSDEKLLASAEKKH
KKDVLAPVLVLRDGEPVEVELNLGTSARESEFSWRLETEQGEVLEGYLQSQIVRDERAEG
GPLVFALPKNLAWGYHKLIISRKRRKTPYEMSLIITPKACYKQDALNEHKKLWGPSIQLY
TLRTQHNWGIGDFGDLKQLVSDIASRGGDFIGLNPIHSLFPANPEGASPYSPSSRRWLNI
MYIDVVSVPEFALSAEAQQQVGSAEFQQRLQKARDSHWVNYTEVSALKMSVLPLLFSEFK
ARHLDKNTDRARAFLEFVEKGGDSLLHQAAFDALHAYLHAEDANVWGWPAFPEKYRTFES
AGTQKYIKDQKDRVHLYMYLQWIADDQIKEAQALAEEKGMSVGLYRDLAVGVADSGSETW
ADEGNLVLDASIGAPPDVLGPLGQNWGLPPLNPQVLEATGYDAYIQLLRANMKHCGSLRI
DHVLGLLRLWWIPKGEKATEGAYLYYPVEDMLAILALESHRHQCSVIGEDLGTVPDEIVD
ILRDAGVHSYKVFFFETSKDDGGFISPKHYAEQSMAALCTHDMPTLRGFWHCDDLKMGRE
IGLYPDEEQLEGLFADRLKCKQGILDSVRWHGYLPEGIGHDAQFVPMDSYLSEALQLHVA
AGDSALLSVQLEDWLEMDQPVNIPGTVDEYPNWRRKLSMNLDEIFSREDVNRIAKRLTEV
RAQASK
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaactaacagcattaaagaaagtcgcggaaatggcgagattggctgacagttac
gtcagtgcatggggagatgaggctaaagtgtctgatgagactctgcgccgtttgctcgct
tcacttggctacgatactagcagcgatgaaaaactattggcttctgctgagaagaagcat
aagaaagacgtactagcccctgttcttgttttacgcgacggcgagcctgtcgaagtggaa
ctaaacctaggtacgagtgctcgtgagagtgaattcagctggcgtttagaaacagagcaa
ggagaggtacttgaaggctatcttcagtctcaaattgttcgtgatgaacgtgctgagggt
ggccctctagtgtttgcattgccaaagaacttggcatggggttatcacaaactgatcatc
agtcgtaagcgtcgtaaaacgccttatgaaatgtcgctgatcatcactccaaaagcttgt
tacaaacaagatgcgcttaacgaacacaaaaagctttggggcccgagtattcagctttac
acattgcgtactcagcataactggggtatcggtgatttcggagaccttaagcaactggtt
agtgacattgcttcgcgtggcggagacttcattggcctgaacccaattcactcgttgttc
ccggcaaacccagaaggtgcgagcccatacagcccgtcttctcgccgctggttgaacatc
atgtatattgatgtggtatccgtaccggaattcgctctgagtgcagaagcgcagcaacaa
gttggcagtgctgaattccagcagcgtctacaaaaagctcgtgattctcattgggttaat
tacaccgaagtctcagctcttaaaatgagcgtactgcctttactgtttagcgagttcaaa
gcgcgtcatctggacaagaatacagaccgtgcacgtgcattcttagaattcgtagagaaa
ggcggcgacagcttgttacatcaagctgcctttgacgcacttcatgcctatctgcacgca
gaagatgccaacgtgtggggttggccagcgttccctgaaaaataccgtacattcgagtcg
gctggaacgcagaaatacattaaagatcaaaaagaccgcgttcacctgtacatgtactta
cagtggatcgctgatgatcaaatcaaagaagctcaagcacttgcagaagaaaaaggcatg
tctgtaggtctgtaccgtgaccttgcagtaggcgtagcggattctggcagtgaaacttgg
gctgacgaaggtaaccttgttctggacgcaagtattggtgcgccaccagatgtactgggc
ccactaggtcaaaactgggggctgcccccactaaacccacaagtgcttgaagcaacgggt
tacgacgcttacatccaactgctgcgtgccaacatgaagcattgtggttcgctacgtatt
gaccatgtactcggtctgctgcgtctgtggtggattccaaaaggcgaaaaggcaacagaa
ggggcttacctgtactacccagtagaagacatgctggcaatcttagcgcttgagtcacat
cgtcatcaatgttcagttattggtgaagacttaggtacggtgccagatgaaatcgtagat
attcttcgcgatgctggtgtgcactcatacaaagtgtttttctttgaaacctcaaaagac
gacggcggcttcatttctcctaagcattatgctgagcaatctatggcggcactgtgtacg
cacgatatgccaacgctacgcggtttctggcactgtgatgacttgaaaatgggtcgtgag
attggtctgtacccagacgaagagcaactagaaggtctgtttgctgatcgtcttaagtgc
aagcaaggtattctggatagcgttcgctggcatggttatctgcctgaaggcattggccat
gatgcgcagttcgtacctatggattcgtacttaagcgaagcgcttcaactgcatgttgca
gcaggtgattctgcactgcttagtgttcagctggaagactggctagagatggatcaaccg
gtcaatatccctggtactgttgatgagtatccaaactggcgtcgtaagctgtcgatgaac
cttgatgaaattttcagtcgtgaagatgtgaatcgaattgcaaaacgtttaacggaagtc
cgcgctcaggcaagcaagtaa

DBGET integrated database retrieval system