KEGG   Vibrio sp. EJY3: VEJY3_24156Help
Entry
VEJY3_24156       CDS       T01683                                 

Gene name
galM
Definition
(GenBank) galactose-1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
vej  Vibrio sp. EJY3
Pathway
vej00010  Glycolysis / Gluconeogenesis
vej00052  Galactose metabolism
vej01100  Metabolic pathways
vej01110  Biosynthesis of secondary metabolites
vej01120  Microbial metabolism in diverse environments
vej01130  Biosynthesis of antibiotics
Module
vej_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:vej00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VEJY3_24156 (galM)
   00052 Galactose metabolism
    VEJY3_24156 (galM)
Enzymes [BR:vej01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     VEJY3_24156 (galM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: AEX25240
UniProt: H2IND1
Position
2:complement(1917090..1918169)
Genome map
AA seq 359 aa AA seqDB search
MPNSIIPPDSIKAAIEHDLFTDGKPATVHILRNHHGMTATFMDIGATWLSCQLPTSSGPR
EVLLGMTSLHDYQSHSAFLGATIGRFANRIAKGQFNLNGQTYSITRNNNGNSLHGGIEGF
DKRRWLVKDKSDSHITYCLMSPDGDQGFPGNLTAEVAYTLTENNQLCIEYSAICDQDCPI
NLTNHAYFNLDGAESGKTILDHELQLLANEYLPTDEDLIPTGELKAVQGTSFDFGRSQVI
RDRLLEDEDQKLAKGYDHAFTLTEELTDGVSTIARLTSSDKLVEMSVFTDKPAIQFYSGN
FLAGTPSRNGEYRDYQGLALETQFLPDCPNHPEWPEANKRFITQKSFYQHQTSYQFNFQ
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgcccaacagcattatcccacccgactcgatcaaggctgcgattgagcacgatcttttc
accgatggtaagcctgcgacggttcatatattacgtaatcatcacggcatgacagctacc
tttatggacattggtgccacatggctaagttgtcagcttccgacttcctctgggccaaga
gaagttctgctcggcatgacctcgctgcacgattatcagtctcattctgcttttttaggt
gcgaccattggccggttcgccaaccgcattgctaaggggcagttcaacttaaacggacaa
acctattccattactcgcaacaataatggcaatagcctacatggcggtattgaaggtttt
gataaacgccgctggctagtgaaagataaaagcgattcacacattacttactgtttgatg
tctcccgatggtgaccaaggcttcccggggaaccttactgctgaagtggcttatacactg
acggaaaacaatcagctatgcatcgaatactcggcgatttgtgaccaagactgtccaata
aacctgaccaaccacgcctactttaatttagacggcgcggaatctggcaagaccattctc
gatcatgagctgcaattgctggccaacgaatacctgccgactgatgaagatctcatacca
actggcgagctgaaagcagtacaagggaccagttttgactttggtcgctctcaggtaatc
agagatcgattgttagaggatgaagaccagaagctagccaaaggctatgaccacgctttt
accttaaccgaagagttaacggatggcgttagcactatcgctcgcctgactagctcagac
aagctggtggagatgtcagtgtttaccgataaacctgcgattcagttttacagcggtaac
ttcttggcaggaacgccttctcgcaatggggagtatcgcgattatcaaggcctagcgctt
gaaactcagttcttaccggattgcccaaaccacccagaatggccagaggcgaacaaacgc
tttattactcaaaagtcgttctatcagcatcaaaccagttaccagttcaactttcaataa

DBGET integrated database retrieval system