KEGG   Vibrio sp. Ex25: VEA_000168Help
Entry
VEA_000168        CDS       T01107                                 

Definition
arylesterase precursor (EC:3.1.1.2)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
vex  Vibrio sp. Ex25
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:vex01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:182303..182905
Genome map
AA seq 200 aa AA seqDB search
MIRILSLVLFFCFSATAHASEKLLVLGDSLSAGYQMPIEKSWPSLLPDALSEHGQDVTVI
NASISGDTTGNGLARLPQLLTQHSPDMVLIELGANDGLRGFPPKLITSNLSKMITMIKDS
GADVVMMQIRVPPNYGKRYSDMFYDIYPKLAQHQQVTLMPFFLEHVVIKPEWMMDDGLHP
KPDAQPWIADFVAQELIKHL
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgattcgtatactttccttagttctatttttttgtttttccgctactgcacatgcgagc
gaaaagctacttgtcttaggtgatagcctgagcgcgggctatcagatgccgatcgaaaag
agttggcctagcttactccctgatgcgttgtcagaacatggtcaagatgtaacagttatt
aatgccagcatttctggcgataccacaggcaacggtttagctcgattaccacagctacta
acccaacacagccctgatatggtgctcattgagttaggtgccaacgatggcctaagaggt
ttccctcctaaacttattacgtcgaatctctcaaaaatgattaccatgataaaagattca
ggagcggacgttgtcatgatgcaaattcgagtgccacctaattatggtaagcgctatagc
gatatgttttacgatatctaccctaagcttgcacaacatcaacaagttaccttgatgcca
ttcttcttggagcatgtggtcatcaaacccgagtggatgatggatgatggccttcacccc
aagcctgatgcacagccttggattgctgactttgttgctcaagaattaattaaacatctc
taa

DBGET integrated database retrieval system