KEGG   Vibrio sp. Ex25: VEA_000246Help
Entry
VEA_000246        CDS       T01107                                 

Definition
outer membrane phospholipase A (EC:3.1.1.32 3.1.1.4)
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
vex  Vibrio sp. Ex25
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vex00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    VEA_000246
   00565 Ether lipid metabolism
    VEA_000246
   00590 Arachidonic acid metabolism
    VEA_000246
   00591 Linoleic acid metabolism
    VEA_000246
   00592 alpha-Linolenic acid metabolism
    VEA_000246
Enzymes [BR:vex01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     VEA_000246
    3.1.1.32  phospholipase A1
     VEA_000246
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(268358..269386)
Genome map
AA seq 342 aa AA seqDB search
MASKVAGISILSLLAAPVAMGETASAYDLCLLDKIKQSKGEETIKSIRAQCELDAVTSTV
PADPEIEEPEELQESLVDKRLESERENAFEPFSLVAHRVNYILPFTYSDRVNKRAYADTK
YGDELRKEEAEFQISFKVPMNYDDLLFDGDGLFFGMTLKSFWQVYTGAASRPFRETNYRP
ELFYYTPTDWKPLDGSTWLGFGIEHESNGQRQELSRSWNRVYANLTFAKDNFAVSLQPWW
RIPEDEKTSPNDPKGDDNPDIEDYMGHFELSSAYKWNGYEFTFLGRQNFQTHKGFAELGV
SFPIWGKLQGYAQYSTGYGKSLIDYDHNQQRIGVGIAINGVL
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggcttcaaaagtggcagggatatcaatactgagcttgttggcagcgccagttgcgatg
ggagaaacagccagtgcttatgatttatgtttgctagacaaaatcaagcaaagcaaaggt
gaggaaaccataaagagcattcgcgcgcagtgtgagcttgatgcagtaacaagtacagtg
cccgcagatccagaaattgaagaacctgaggagcttcaggaaagcttggtcgacaagcgt
ttggagtcagaacgagaaaacgcctttgaaccatttagtttggtagcgcatcgtgttaac
tacatcttgccgttcacttacagtgatcgcgtaaataagcgtgcttatgcggacactaag
tacggggatgagctgcgtaaggaagaagcggagttccaaattagttttaaagtgccaatg
aactacgacgatttgttgtttgatggggatggtttgttctttggtatgacgctcaagtca
ttttggcaggtgtatacaggagcagcatcgcgtccatttcgtgaaaccaattatcgtcct
gagcttttttattatactccgacagactggaagccacttgatggttcgacttggttaggt
tttggtattgaacatgagtcgaatgggcagagacaagagttatcgcgcagttggaatcgt
gtttacgccaacttaacctttgcgaaagacaattttgcggtttctcttcaaccgtggtgg
cgtatacctgaggatgaaaaaacatctccgaatgatcctaaaggtgatgataacccggat
atcgaagattacatggggcactttgagctatcgagtgcgtacaaatggaatggttatgag
tttaccttcttaggccgccagaacttccaaacgcataaaggctttgccgaattaggggtg
tcatttccgatctggggcaaacttcagggatacgcacagtactcgacggggtatggtaag
agcttgattgactatgatcataatcagcagcgcattggtgttggtatcgcgatcaacggt
gttctgtag

DBGET integrated database retrieval system