KEGG   Vibrio sp. Ex25: VEA_000292Help
Entry
VEA_000292        CDS       T01107                                 

Definition
delta-9 fatty acid desaturase (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
vex  Vibrio sp. Ex25
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:vex00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    VEA_000292
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    VEA_000292
Enzymes [BR:vex01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     VEA_000292
Lipid biosynthesis proteins [BR:vex01004]
 Desaturase
  First
   VEA_000292
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:314062..315051
Genome map
AA seq 329 aa AA seqDB search
MAFSFTNLSITAGYHRLWSHKTYEAHPILRAIFAIGGAFSLQNSALHWSSDHRVHHKHVD
NNDKDPYSAKRGFWYSHIGWMLRDYNKSQENEYTNCRDLKRDKIVMWQHKYYVPLALLTN
IGFPVALGIIYGDIWGMLLVVGAARLFMSHHTTFFINSLAHVWGKQTFTDKNTARDNGVL
AFFTFGEGYHNFHHIFENDYRNGVYWWHYDPTKWLIKSCSWLGLTSKLRTTPTFRIEKAR
ATQLLKKAKEKLGAKPNTQTILDQLQHEFDSLVHHMQEYYEMRKEVLGAKTASVVKKYEC
SVTKIKYQQIKAEFERQQRSWNLMVRRYA
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atggcattcagttttacgaatctttctattacagcaggctatcaccgactctggagccac
aaaacatacgaagctcatccaattttacgtgctatttttgcgattggaggagcattttct
ttgcaaaatagtgcattacactggtcttctgatcatcgtgtacaccacaagcatgtcgac
aataacgacaaagatccttactcagcgaaacgtggcttttggtattctcatattggttgg
atgttacgcgactacaacaaatcgcaggaaaacgaatacaccaactgccgcgatttaaag
cgtgacaaaatcgtcatgtggcaacataagtactatgttccacttgctctactcaccaat
attggctttccggtcgctcttggtattatctacggcgatatttggggtatgttattagta
gttggtgccgctcgactctttatgagccaccacacgacctttttcattaactcacttgcg
catgtttggggaaaacagactttcacggacaaaaacaccgctcgcgacaacggcgtgtta
gcctttttcacatttggtgagggctaccacaatttccatcatatcttcgagaatgactat
cgtaatggtgtgtattggtggcattacgacccgaccaagtggttgattaagtcttgttct
tggcttggactcacatctaagttgcgcacaacgcctacatttagaattgaaaaagctcgc
gcaactcaactcttgaagaaagcaaaagaaaaactgggagcaaaaccgaatacgcagacg
attctcgatcagttacaacacgagtttgattcgctagttcatcacatgcaggaatattat
gagatgcgaaaggaagtactcggtgcaaaaacagccagtgtagtaaaaaaatacgagtgc
tctgtgaccaagataaagtatcagcaaatcaaagcggagttcgagcggcaacaacgcagt
tggaacctcatggtgcgccgatacgcttaa

DBGET integrated database retrieval system