KEGG   Vibrio sp. Ex25: VEA_000338Help
Entry
VEA_000338        CDS       T01107                                 

Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
vex  Vibrio sp. Ex25
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:vex00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    VEA_000338
Enzymes [BR:vex01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     VEA_000338
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(381096..382013)
Genome map
AA seq 305 aa AA seqDB search
MNKLVVLGSVNADHVLQVPSFPRPGETLHGRNYQVIPGGKGANQAVAAARLKADIGFIAC
VGDDSFGINIRENFNMDGIDITGVKMQPNCPTGIAMIQVSDSGENSICISAEANAKLTAE
AIEPDLDRIRQADYLLMQLETPMCGIEKAARVAKDAKTNVILNPAPARELSDELLACIDV
ITPNETEAEVLTGVTVTDNDSAQEAANVLHSKGIEIVMITLGAKGVWLSQNGRGELIPGF
RVDATDTTAAGDTFNGAFVTGLLEDLPLESAIKFAHAAAAISVTRFGAQTSIPTREEVDA
FLAAQ
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgaataagttagtggtgttaggtagtgtaaacgctgaccatgttcttcaagtgccttct
ttccctcgccctggcgaaacgctacatggtcgcaactatcaagttatcccaggtggcaaa
ggtgccaaccaagctgttgctgcagctcgactcaaggctgatattggctttattgcttgt
gtaggcgatgactcgttcggcatcaatattcgtgaaaacttcaatatggacggcatcgac
atcactggtgtgaagatgcaaccaaactgcccaactggcattgcgatgattcaagtgtcg
gatagtggtgaaaacagcatttgtatttcagcagaagcgaatgccaaattgacagcagaa
gcgattgagccagatttagatcgcattcgccaagcggattacctgctgatgcaattggaa
acgccgatgtgcggaattgagaaagccgcgcgagtggcgaaagatgcaaaaactaacgtc
attttaaaccctgcccctgctcgtgaactgtcagacgaactgcttgcttgtattgatgtc
attacaccaaatgaaaccgaagctgaagtcctgacgggggtaacggtaacggataatgac
agcgcgcaagaagcggcgaatgtgcttcatagcaaaggtatcgaaattgtcatgatcact
ctcggtgcgaagggtgtttggttaagtcaaaatggtagaggtgagctcatcccggggttc
cgtgttgacgcgactgataccaccgcagcaggggatacgtttaatggggcattcgtcact
ggcctgttagaggatttacctttagaatcagcaattaagtttgcacatgcggcggctgca
atttctgtgacccgctttggcgctcagacgtcgatcccaactcgcgaagaggtggacgcg
tttctcgcagcacaatag

DBGET integrated database retrieval system