KEGG   Vibrio sp. Ex25: VEA_000573Help
Entry
VEA_000573        CDS       T01107                                 

Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
vex  Vibrio sp. Ex25
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:vex00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:vex00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:673202..673747
Genome map
AA seq 181 aa AA seqDB search
MKGLLKLVALVGFLSMNSLALASECPDILQGKQRLLNSTEEVDLCESFKGKTLLVVNTAS
QCGFTPQFEQLETLYQTYKEQNFTVIGFPSNDFRQDRGSETNTAKVCYLDYGVTFPMMAR
SSVLGVDANPVFSEITNQAGIKPKWNFYKFLISSEGKVIATFPSSTSPTSTTLTNMIEQQ
L
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggattactgaaactcgtcgctctcgttggctttctctccatgaattcgcttgct
cttgcatctgagtgccctgatattcttcaaggtaagcaaaggttgttaaactcaacagaa
gaagtcgatctatgcgaaagctttaagggaaagacactactagtcgtcaatacagcaagc
cagtgcggcttcactcctcagttcgaacagttagaaaccctctatcaaacttacaaagag
caaaacttcaccgtcattggtttcccgagcaatgacttccgacaggacagaggaagcgaa
acaaacactgcgaaagtctgttatctcgattacggggtcacctttccaatgatggctcgc
tcctcagtattaggcgtagatgcaaaccccgtattcagcgagattactaaccaagctggc
atcaaaccaaaatggaacttctataagtttctaattagctctgaaggcaaagttattgcc
acttttccaagctccacatcaccgacaagtactacgcttaccaatatgatagagcaacaa
ttgtaa

DBGET integrated database retrieval system