KEGG   Vibrio sp. Ex25: VEA_000797Help
Entry
VEA_000797        CDS       T01107                                 

Definition
GGDEF family protein
Orthology
K13590  
diguanylate cyclase
Organism
vex  Vibrio sp. Ex25
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:913567..914580
Genome map
AA seq 337 aa AA seqDB search
MTDEFKKSTANLKKAVPLMIKNHVAATPANYALWYTYVDKTIPELNFELDTVLENYGICP
PATNKQLYNNYVASKAETSLEDLRTNVEVLLHEVSSSMSDTLSDTSSFSEMVDKSFNKLE
KVEDNSLSIEEVMVVIRQLVAESHEIRHSTKFLNSQLTNASEEISRLKNQLAEVQQDALF
DGLSNLYNRRAFDKDLSSLIASNQAMTLIMLDIDHFKSFNDNYGHLFGDTVLKAIARRLQ
QSCRDGICAYRFGGEEFALIVPNKSLRIARQYADTLRRMIEKLRIRDKRSGTQVHSITAS
FGVAEYEVGDTPEALVNKADKQLYEAKQLGRNRVMPI
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgagtttaaaaaatcgaccgctaatttgaaaaaagcggtcccactaatgatc
aaaaatcatgttgctgccacgccagccaactatgcgctttggtatacctacgttgacaag
accattcctgaactcaactttgagttggatacggtgttagaaaactacggtatctgcccg
cctgcaaccaataaacagctttataacaactatgttgccagtaaagcagaaactagcctt
gaagatcttagaaccaatgtagaagttctgctgcatgaagtgtccagctcgatgagcgat
acactttcagatacttcttccttttctgaaatggtagacaaaagttttaataagctagaa
aaagttgaagacaacagcttaagtattgaagaagtgatggtggtgattcgtcaacttgtc
gcagagtcacacgaaattcgtcactcgacaaagtttttgaatagccaattaactaatgcg
agtgaagaaatttctcgcctcaaaaatcagctggctgaagtacagcaagacgcattgttt
gatggtctatccaacctttacaaccgtcgagcttttgataaagatctgtcttcgcttatc
gcatcaaatcaagcaatgaccttgatcatgcttgatatcgaccatttcaagtcatttaac
gacaattatggccaccttttcggcgatacggtactaaaagccattgcccgtcgactacaa
caaagctgtcgagatggaatatgcgcgtatcgttttggtggtgaagagttcgctttaatt
gtgcccaataaatctctgcgaattgctcgccaatatgcagacacactacgccgcatgata
gaaaaactgcgcatcagagataagcgttctggtacacaagttcacagcattactgcttct
tttggggtagcagaatatgaggtgggtgatacacctgaagctctggtcaataaagccgat
aagcaactttatgaggcaaaacaactcggtcgtaaccgcgtgatgcccatttaa

DBGET integrated database retrieval system