KEGG   Vibrio antiquarius: VEA_000797Help
Entry
VEA_000797        CDS       T01107                                 

Definition
(GenBank) GGDEF family protein
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
vex  Vibrio antiquarius
Brite
Enzymes [BR:vex01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     VEA_000797
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2:913567..914580
Genome map
AA seq 337 aa AA seqDB search
MTDEFKKSTANLKKAVPLMIKNHVAATPANYALWYTYVDKTIPELNFELDTVLENYGICP
PATNKQLYNNYVASKAETSLEDLRTNVEVLLHEVSSSMSDTLSDTSSFSEMVDKSFNKLE
KVEDNSLSIEEVMVVIRQLVAESHEIRHSTKFLNSQLTNASEEISRLKNQLAEVQQDALF
DGLSNLYNRRAFDKDLSSLIASNQAMTLIMLDIDHFKSFNDNYGHLFGDTVLKAIARRLQ
QSCRDGICAYRFGGEEFALIVPNKSLRIARQYADTLRRMIEKLRIRDKRSGTQVHSITAS
FGVAEYEVGDTPEALVNKADKQLYEAKQLGRNRVMPI
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgagtttaaaaaatcgaccgctaatttgaaaaaagcggtcccactaatgatc
aaaaatcatgttgctgccacgccagccaactatgcgctttggtatacctacgttgacaag
accattcctgaactcaactttgagttggatacggtgttagaaaactacggtatctgcccg
cctgcaaccaataaacagctttataacaactatgttgccagtaaagcagaaactagcctt
gaagatcttagaaccaatgtagaagttctgctgcatgaagtgtccagctcgatgagcgat
acactttcagatacttcttccttttctgaaatggtagacaaaagttttaataagctagaa
aaagttgaagacaacagcttaagtattgaagaagtgatggtggtgattcgtcaacttgtc
gcagagtcacacgaaattcgtcactcgacaaagtttttgaatagccaattaactaatgcg
agtgaagaaatttctcgcctcaaaaatcagctggctgaagtacagcaagacgcattgttt
gatggtctatccaacctttacaaccgtcgagcttttgataaagatctgtcttcgcttatc
gcatcaaatcaagcaatgaccttgatcatgcttgatatcgaccatttcaagtcatttaac
gacaattatggccaccttttcggcgatacggtactaaaagccattgcccgtcgactacaa
caaagctgtcgagatggaatatgcgcgtatcgttttggtggtgaagagttcgctttaatt
gtgcccaataaatctctgcgaattgctcgccaatatgcagacacactacgccgcatgata
gaaaaactgcgcatcagagataagcgttctggtacacaagttcacagcattactgcttct
tttggggtagcagaatatgaggtgggtgatacacctgaagctctggtcaataaagccgat
aagcaactttatgaggcaaaacaactcggtcgtaaccgcgtgatgcccatttaa

DBGET integrated database retrieval system