KEGG   Vibrio sp. Ex25: VEA_000798Help
Entry
VEA_000798        CDS       T01107                                 

Definition
(RefSeq) malate synthase-related protein
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
vex  Vibrio sp. Ex25
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:vex00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VEA_000798
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    VEA_000798
   00630 Glyoxylate and dicarboxylate metabolism
    VEA_000798
Enzymes [BR:vex01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     VEA_000798
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(914685..915263)
Genome map
AA seq 192 aa AA seqDB search
MNMLNFDKKEMQQQQRPFIAEAVFAVEAVSAEQQSEKQVKAKQLLDRMFPLENGSHQDVS
SYVIDYRHVLAYFKDGTHSGLKSPKHFVAYTGEKEDPKSILFKDDSGNHVEVLFGCHKGT
GCVELMDIDDIQLETRTTFNPELTGNAPTAMRHWISLIKGDKKGKPMACSEDKEYTAKNG
DDYILSYCYSVD
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgaatatgctgaacttcgataaaaaagagatgcaacaacaacaacgcccatttatcgct
gaagctgtatttgccgtcgaagcggtaagtgctgagcagcagagcgagaagcaagtaaaa
gcgaagcaactactagaccgcatgttcccattggagaacgggtcgcaccaagatgtatca
agttacgtaattgattaccgccatgtattggcttacttcaaagacggcacacacagcggc
ctgaaaagcccaaaacactttgtggcgtatacgggtgagaaagaagatccaaaatcgatc
ttgtttaaagacgattcaggtaaccacgtagaagtgctatttggctgtcataaaggcacc
ggttgtgtggagttgatggatattgatgacattcaactggaaacacgcactacgtttaat
cctgaactaacgggtaatgcgccgacggcgatgcgccactggatcagcttaatcaaaggc
gacaaaaaaggtaagccgatggcatgcagtgaagataaagaatacactgcgaaaaacggt
gacgactatattctaagctactgctacagtgtcgattaa

DBGET integrated database retrieval system