KEGG   Vibrio sp. Ex25: VEA_000798Help
Entry
VEA_000798        CDS       T01107                                 

Definition
malate synthase-related protein
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
vex  Vibrio sp. Ex25
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:vex00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VEA_000798
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    VEA_000798
   00630 Glyoxylate and dicarboxylate metabolism
    VEA_000798
Enzymes [BR:vex01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     VEA_000798
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(914685..915263)
Genome map
AA seq 192 aa AA seqDB search
MNMLNFDKKEMQQQQRPFIAEAVFAVEAVSAEQQSEKQVKAKQLLDRMFPLENGSHQDVS
SYVIDYRHVLAYFKDGTHSGLKSPKHFVAYTGEKEDPKSILFKDDSGNHVEVLFGCHKGT
GCVELMDIDDIQLETRTTFNPELTGNAPTAMRHWISLIKGDKKGKPMACSEDKEYTAKNG
DDYILSYCYSVD
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgaatatgctgaacttcgataaaaaagagatgcaacaacaacaacgcccatttatcgct
gaagctgtatttgccgtcgaagcggtaagtgctgagcagcagagcgagaagcaagtaaaa
gcgaagcaactactagaccgcatgttcccattggagaacgggtcgcaccaagatgtatca
agttacgtaattgattaccgccatgtattggcttacttcaaagacggcacacacagcggc
ctgaaaagcccaaaacactttgtggcgtatacgggtgagaaagaagatccaaaatcgatc
ttgtttaaagacgattcaggtaaccacgtagaagtgctatttggctgtcataaaggcacc
ggttgtgtggagttgatggatattgatgacattcaactggaaacacgcactacgtttaat
cctgaactaacgggtaatgcgccgacggcgatgcgccactggatcagcttaatcaaaggc
gacaaaaaaggtaagccgatggcatgcagtgaagataaagaatacactgcgaaaaacggt
gacgactatattctaagctactgctacagtgtcgattaa

DBGET integrated database retrieval system