KEGG   Vibrio sp. Ex25: VEA_000818Help
Entry
VEA_000818        CDS       T01107                                 

Definition
6-phospho-beta-glucosidase (EC:3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
vex  Vibrio sp. Ex25
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:vex00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VEA_000818
Enzymes [BR:vex01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     VEA_000818
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:942480..943871
Genome map
AA seq 463 aa AA seqDB search
MIKFPDNFLWGGAIAANQVEGAYNFGGKGLSTSDMLPNGILSPHQTREERTPGIKDLAID
FYNRYPEDIALFKEMGFTCLRLSIAWSRIFPNGDELEPNEEGLAFYDKIFDELAKHNMQP
FVTLSHYEMPYALVENYGGWGDRRVIEFFERYAKTVLERYKDKVKLWLTFNEINMSLHAP
FTGVGLQEDASEQDIYQAIHHQLVANAKAVKLCQQIVPNGKIGNMLLGAINYPYTCNPDD
VLAAMHENNKWLFFGDVQTRGQYPGYMKRYFRENGIEIQMEAGDLEEIASASVDFISFSY
YASGCASADPKQKEVGNIVDSVPNPYLEKSQWGWLIDPKGLRVLLNFLHDRYQKPLFIVE
NGLGARDEFDENGEIQDDYRISYLNDHLVQAHEAILDGVELMGFTSWGPIDLVANSTAEM
SKRYGYIYVDRHDDGQGTLERKRKKSFYWYQDVIRTSGGSLKS
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgattaagtttccagataatttcctttggggtggtgccattgcggcaaaccaggtagag
ggggcatacaactttggggggaaaggtttatcaacatcagatatgttgccaaacggcatt
ctaagcccgcatcaaacgcgtgaagaacgaacgcctggtatcaaagatcttgcgatcgat
ttctacaatcgctatccagaagatattgccctgtttaaagagatgggattcacctgcctg
cgcttgtccatcgcttggagtcgtatttttcctaatggtgatgaactggagccaaacgaa
gaaggactggcgttttacgacaaaatttttgatgagctagccaaacacaatatgcaacca
tttgtgacgctttctcattacgagatgccttacgccttggttgagaattatggtggttgg
ggcgatcgtcgagtgatcgagtttttcgagcgttacgctaaaaccgtgttagaacgctac
aaagacaaagtgaagctgtggcttacctttaacgaaatcaacatgtcacttcatgcgcca
tttacgggagtgggcttgcaagaagacgccagtgaacaagacatttatcaagcgattcac
caccagcttgtagcaaacgcgaaagcggtaaaactgtgtcagcaaatcgtaccaaacggc
aagattggtaacatgctgcttggcgcaatcaactacccatacacctgcaaccctgatgat
gtgcttgctgctatgcatgaaaacaataagtggttgttcttcggtgatgtgcagactcgt
ggtcagtacccaggctacatgaaacgttacttccgtgaaaacggcattgaaatacaaatg
gaagctggcgacttagaagaaattgcatcggccagtgtcgattttatttccttcagctac
tacgcaagtggctgtgcgagtgccgatccgaaacagaaagaagtgggtaacatcgtcgat
agcgtaccaaacccataccttgaaaagagccaatggggctggttgatcgatccaaaaggc
ctgcgcgttttgcttaacttccttcacgatcgttaccaaaagccgctatttatcgtcgag
aatggcttaggcgctcgcgatgaattcgatgaaaacggggaaatccaagacgattatcga
atctcataccttaatgatcatttggttcaagcacacgaagcgattcttgatggcgttgag
ttgatgggcttcaccagctgggggccaatcgacttggtggctaactcaacagccgaaatg
agcaagcgttacggttatatttatgtcgatcgtcatgatgatgggcaaggaacgctagaa
cgtaaacgcaagaagagcttctactggtatcaagacgtgattcgtacttcaggcggttca
ttgaaaagctaa

DBGET integrated database retrieval system