KEGG   Vibrio sp. Ex25: VEA_000829Help
Entry
VEA_000829        CDS       T01107                                 

Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
vex  Vibrio sp. Ex25
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vex00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    VEA_000829
Enzymes [BR:vex01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     VEA_000829
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:954687..955607
Genome map
AA seq 306 aa AA seqDB search
MNDLFTKNDYSLYSNSMSFLRLPYIRNPVSADADVVVLGVPLDMATSGRPGARMGPDAIR
RASVNLAWEGKKFPWDFNVLDKLKVIDAGDLVFDCGDAEDFTYRLEAATSEILKSGKTML
GLGGDHFITLPILRAYAKHHGQMALIHFDAHTDTYANGSSYDHGTMFYHAPKEGLISAKN
SVQIGIRTEYKQQDHGFNVINAMQANDMSVNEILEEIRRTVADKPVYVTFDIDCLDPAFA
PGTGTPVCGGLNSDKALKIIRGLAGMNIVGMDVVEVSPPYDHSDVTALAGATIALEMLYA
YASGRE
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgaatgatttgtttactaaaaacgattattcgctttactccaactctatgtcgttttta
cgtctaccgtacattcgtaatccggtatcggcagacgcagacgttgtggtgctaggggtt
cctctggacatggctacatctggtcgtccaggcgcgcgcatgggtccagatgcgattcgc
cgtgcctcagtcaacttggcatgggaaggtaagaagttcccttgggacttcaacgtattg
gataagctgaaagtgatcgacgcgggcgatctcgtgtttgactgtggtgatgcggaagat
ttcacttaccgtctagaggcggcaaccagtgaaattctaaaaagcggtaaaaccatgttg
ggattgggcggtgaccacttcatcacactgcctatcctgcgtgcctacgcgaagcatcat
ggtcaaatggctctgattcactttgacgctcatacggatacctacgcaaatggcagttca
tacgaccacggtacaatgttctaccatgcgccgaaagaaggtttgatctctgcgaagaac
tcagtacaaatcggtattcgtactgaatacaaacagcaagatcacggcttcaatgtgatt
aatgcgatgcaagcgaatgacatgtcggtgaacgagatcttagaagagattcgtcgcacc
gtcgcagacaagccagtgtatgttacttttgacatcgactgcttggatccagccttcgca
ccaggaacaggtacacccgtttgtggtggcttgaactcagacaaagcactgaagatcatt
cgtggcttagccggtatgaatattgtgggtatggatgttgtagaagtatcgcctccgtac
gaccacagtgatgttaccgcattagcgggagcaaccatcgcgctagaaatgctttacgca
tacgcatctggccgcgaataa

DBGET integrated database retrieval system