KEGG   Vibrio sp. Ex25: VEA_001104Help
Entry
VEA_001104        CDS       T01107                                 

Definition
4-alpha-glucanotransferase (amylomaltase) (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
vex  Vibrio sp. Ex25
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vex00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    VEA_001104
Enzymes [BR:vex01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     VEA_001104
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:1265998..1268178
Genome map
AA seq 726 aa AA seqDB search
MKEQTALKKVAEMARLADSYVSAWGDEAKVSEETLRRLLASLGYDTSSDEKLLASAEKKH
KKDVLAPVLVLRDGEPVEVELNLGTSARESEFSWRLETEQGEVLEGYLQSQIVRDERAEG
GPLVFALPKNLAWGYHKLIISRKRRKTPYEMSLIITPKACFKQDDLNQHKKLWGPSIQLY
TLRTQHNWGIGDFGDLKQLVSDIASRGGDFIGLNPIHSLFPANPEGASPYSPSSRRWLNI
MYIDVSSVPEFALSAEAQQRVGSAEFQQRLQKARDSHWVNYTEVSQLKMSVLPLLFSEFK
ARHLDKNTDRARAFLDFVEKGSDSLLHQAAFDALHADLHAEDSNMWGWPVFPEKYRTFDA
AGTQKYIKDNQDRVHLYMYLQWIADDQIKEAQSLAEEKGMAVGLYRDLAVGVADSGSETW
ADDGNLVLDASIGAPPDVLGPLGQNWGLPPLNPQVLEATGYDAYIKLLRANMKHCGALRI
DHVLGLLRLWWIPKGEKATEGAYLYYPVEDMLAILALESHRHQCSVIGEDLGTVPDEIVD
ILRDAGVHSYKVFFFETSKEDGGFISPKHYAEQSMAALCTHDMPTLRGFWHCDDLKMGRE
IGLYPDEKQLEGLFADRLKCKQGILDSVRWHGYLPEGIGHDAQFVPMDSYLSEALQLHVA
AGDSALLSVQLEDWLEMDQPVNIPGTVDEYPNWRRKLSMNLDEIFSREDVNRISKRLTEV
RAQASK
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaacaaacagcattaaagaaagtcgcggaaatggcgagattggctgatagctat
gtcagtgcttggggagatgaggcaaaagtgtctgaggagacgctacgccgcttgctcgct
tcgcttggctacgatactagcagcgatgaaaaactattggcttctgctgaaaagaaacat
aaaaaagacgtactagcccctgttcttgttttacgcgacggcgaaccagtcgaagtggaa
ctaaacctaggtacgagtgctcgtgagagtgaattcagctggcgtttagaaacagaacaa
ggagaggtacttgaaggctatcttcagtctcaaattgttcgtgatgagcgtgctgagggt
ggccctctagtgtttgcattgccaaagaacttggcatggggttaccacaaactgatcatc
agtcgcaagcgtcgtaaaacgccttacgagatgtcattgatcatcacgccaaaagcgtgt
ttcaaacaagacgatctaaaccaacataaaaagctatggggtcctagtatccagctttac
acactgcgtactcagcacaactggggtatcggtgattttggtgacctaaaacagttggtg
agcgatatcgcttctcgtggcggtgacttcattggtttgaacccgattcactcgctgttc
ccagcgaacccagaaggcgcgagcccatacagtccgtcttctcgtcgttggttgaatatc
atgtacatcgacgtaagttctgtacctgaattcgcactgagtgctgaagctcagcaacgt
gttggcagtgcagagtttcaacagcgtctacaaaaagcacgtgactctcattgggtgaac
tacacagaagtttcgcaactgaaaatgagcgttcttccgctgctgtttagtgagtttaaa
gctcgccatttagacaaaaacaccgaccgcgctcgtgcattcttggactttgtagaaaaa
ggtagcgacagcttgttacaccaagctgcattcgatgcgcttcatgcggatttacacgca
gaagattcaaacatgtggggttggcctgtattccctgagaaataccgcacattcgacgca
gccggtactcagaaatacatcaaagacaaccaagaccgcgttcacttgtacatgtaccta
cagtggatcgcagacgatcaaatcaaagaagcgcagtcactggcagaagaaaaaggcatg
gctgtgggcttgtaccgtgaccttgctgtcggtgttgccgactcaggtagtgaaacttgg
gccgacgacggtaacttagtgttagacgcaagtatcggtgcgccgccggatgtacttggt
cctctgggtcaaaactggggtctgccaccgcttaaccctcaagttttagaagcgacgggt
tacgacgcgtacatcaagttgttacgtgccaacatgaagcactgtggtgcactgcgtatc
gaccacgtacttggcctgcttcgcctttggtggattccaaaaggcgagaaggcgacagag
ggcgcttacttgtactacccagtggaagacatgctcgcaatcctagcgcttgaatctcac
cgtcatcagtgctctgtgattggtgaagacttaggtactgtgccagatgaaatcgtcgat
atcctacgcgatgcaggtgtgcactcatacaaagtgttcttcttcgaaacatcgaaagaa
gacggtgggttcatttctccgaagcactacgcagagcaatcgatggcggcactgtgtacg
catgacatgccaaccctgcgtggtttctggcactgcgatgatttgaaaatgggtcgtgag
attggcctgtacccagatgaaaaacagttggaaggcttatttgctgatcgcttgaagtgc
aaacaaggcatcctagacagcgttcgttggcacggttacttgccagaaggcattggccat
gatgcgcagttcgtaccaatggattcatacctaagcgaagcgctgcaactgcacgtagca
gcgggtgactctgcactgcttagcgttcagcttgaagactggctagaaatggatcaaccg
gtcaacattcctggcaccgtggatgagtatccaaactggcgtcgtaaattgtcgatgaac
ctagatgaaatcttcagccgtgaagatgtgaatcgcatttccaaacgcctcactgaagtt
cgcgcacaggcgagcaaataa

DBGET integrated database retrieval system