KEGG   Vibrio sp. Ex25: VEA_001105Help
Entry
VEA_001105        CDS       T01107                                 

Definition
1,4-alpha-glucan branching enzyme (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
vex  Vibrio sp. Ex25
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:vex00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    VEA_001105
Enzymes [BR:vex01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     VEA_001105
Exosome [BR:vex04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   VEA_001105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:1268410..1270656
Genome map
AA seq 748 aa AA seqDB search
MIQISGLEKDIGSREKDLKTTKTKKIKKQHERAYELLAEAAYSDPFSALGPFIDDGEGSL
RVWMPGANKVELLVNGEPRVALERDGDSGFILKEQRDLHLTHYRLAVDWNGVEQIIDDPY
QYHNIYQEYEHLHTPKDMYHYMGAHFVTLERGGENISGVRFLVYAPHASAVSLVGCFNQW
DGRRHPMQRLDYGIWGLFIPGLEEGVQYKFELKGPNGEGLPHKQDPWGFYSEQYPSFASI
TYDHKRYQWQDAKWQNRAVTQKRDEALSFYELHAGSWKRNEKGDFLNYRELAEQLVPYLV
DMGYTHVELMPVSEHPFYGSWGYQPVGLFAPTSRFGSPDDFKFFVDTCHQAGIGVVLDWV
PAHFPSDDHGLANFDGTPLFHDPDPRRGWHQDWNSYIYDLGREHVRRFLVSNALYWFEQF
HIDGIRVDAVASMLYLDYSRSHDQWVPNVDGGNENYDAIATLKWMNEEVYKHFPNAMTIA
EESTAFPGVSAPTFMGGLGFGFKWNMGWMHDSLSYIKEDPVHRKYHHNTITFPLVYAHSE
NYVLSLSHDEVVYGKGSIHNKMPGDEWQQTANLRAYYGYMYGQPGKKLNFMGAEIGQTAE
WNHDDQLQWFLLEYERHQGVQKLMRDLNHLYRNEAAMHDQDCVPAGFEWRLQDEADASIL
AHERISKEGERILIITNFTPVPHERFRLGVPNAGQYELLLNTDDSKYGGSDFKVLTSVKT
EKVESESLPQSLELRLPPLSTVFYKLNK
NT seq 2247 nt NT seq  +upstreamnt  +downstreamnt
ttgattcagatttctggtcttgaaaaggatattggctctagggagaaagatttgaaaacc
accaaaaccaagaaaataaagaaacaacacgaacgcgcatacgaactgcttgctgaggcg
gcttactcagacccattttcggcgttggggccattcattgatgatggcgaaggatcgctg
cgagtgtggatgccgggcgcaaacaaggttgaactgcttgttaatggcgaacctcgcgtg
gcgcttgagcgtgatggcgacagcggtttcatcttaaaagagcaacgcgatttacacctg
acccactaccgtttggcggtcgattggaatggtgttgaacaaattattgatgacccgtac
cagtaccacaatatttaccaagagtacgagcatctgcatacgcccaaagacatgtatcac
tatatgggcgcacactttgtcacgctagaacgtggcggtgaaaacatctccggtgttcgc
ttccttgtctacgcaccgcatgcatcggctgttagccttgtgggttgcttcaaccaatgg
gacggtcgtcgtcacccaatgcaacgtttagattatggcatttggggcttgttcattcct
ggcttagaagaaggcgttcagtacaaatttgagctcaaagggccaaatggggaagggctg
ccacacaaacaagacccttggggtttttactctgagcagtacccatcgttcgcatccatt
acttacgatcacaagcgttaccaatggcaagatgcgaaatggcaaaatcgcgcagtgaca
caaaagcgtgatgaagcgttatcgttttatgagctgcatgctgggtcatggaagcgcaac
gagaaaggcgatttcctcaactaccgcgaactcgcggagcagctggtgccataccttgtg
gatatgggctacacccacgttgagctgatgcctgtgtctgagcatccattctacggttca
tggggctatcaacccgttggcttgtttgcgccaaccagccgttttggctcacctgatgat
ttcaaattcttcgtggatacatgtcaccaagctggtatcggtgtggtgctggattgggtt
ccggcgcacttcccatcggatgaccacggtttagcaaactttgacggcacaccgctgttc
cacgacccggatccgcgtcgcggttggcaccaagattggaactcatacatctatgattta
ggccgtgagcatgtgcgtcgcttccttgtatcgaatgcgctgtattggtttgaacaattc
catattgatggcattcgcgtggacgcagtcgcatcgatgctctatctcgattattcacgt
agtcacgatcagtgggtaccgaacgtcgacggtggtaacgaaaactacgacgcaatcgca
accttaaaatggatgaacgaagaagtgtacaagcacttcccgaatgcgatgacgattgcg
gaagagtcaacggcgtttccgggtgtgtctgcgccaacctttatgggtgggttaggcttt
ggcttcaagtggaatatggggtggatgcacgacagtctttcatacatcaaagaagatcct
gttcaccgcaaataccaccacaataccatcacattcccgttagtttatgcgcatagcgag
aactacgtcttgtctctctctcacgacgaggtggtgtacggcaaaggttctattcacaac
aagatgccgggcgatgaatggcagcaaaccgcaaacctacgtgcatactacggttacatg
tatggtcaaccgggcaaaaagctgaacttcatgggcgcggaaatcggccaaacggcggag
tggaaccacgatgatcagttgcaatggttcttgctggaatacgaacgtcatcaaggcgtt
caaaagctgatgcgcgatttgaaccacttgtaccgcaatgaagcggcgatgcacgatcaa
gattgtgttcctgctggttttgagtggcgtctacaagacgaggcagatgcaagcatccta
gcgcacgagcgtatcagtaaagagggtgagcgtattctcatcatcaccaactttacgccc
gtaccacacgagcgtttccgtttaggtgttccaaatgcaggtcaatacgaactactgctg
aacacggacgacagcaaatacggcggcagcgattttaaagtgctgactagtgtgaaaacg
gaaaaagtcgaaagtgaatcactgcctcaatcacttgagcttcgtttgcctccactttca
accgtgttctacaagctgaataaataa

DBGET integrated database retrieval system