KEGG   Vibrio antiquarius: VEA_001760Help
Entry
VEA_001760        CDS       T01107                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
vex  Vibrio antiquarius
Pathway
vex00010  Glycolysis / Gluconeogenesis
vex00051  Fructose and mannose metabolism
vex00562  Inositol phosphate metabolism
vex01100  Metabolic pathways
vex01110  Biosynthesis of secondary metabolites
vex01120  Microbial metabolism in diverse environments
vex01130  Biosynthesis of antibiotics
vex01200  Carbon metabolism
vex01230  Biosynthesis of amino acids
Module
vex_M00002  Glycolysis, core module involving three-carbon compounds
vex_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:vex00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VEA_001760
   00051 Fructose and mannose metabolism
    VEA_001760
   00562 Inositol phosphate metabolism
    VEA_001760
Enzymes [BR:vex01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     VEA_001760
Exosome [BR:vex04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   VEA_001760
  Exosomal proteins of bladder cancer cells
   VEA_001760
  Exosomal proteins of melanoma cells
   VEA_001760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ACY49923
Position
1:144305..145075
Genome map
AA seq 256 aa AA seqDB search
MRRPVVMGNWKLNGSKAMVTELLTGLNAELEGVEGVDVAVAPPALYIDLAERVIAEGGNK
IILGAQNTDLNNSGAFTGDMSPEMLKDFGATHIIIGHSERREYHNESDEFIAKKFNFLKE
NGLTPVFCIGESEAQNEAGETEAVCARQINAVIDTYGVEALNGAIIAYEPIWAIGTGKAA
TAEDAQRIHASIRALIAAKDEAVAAQVIIQYGGSVKPENAEAYFSQPDIDGALVGGASLD
AKSFAAIAKAAAKAKA
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgtcctgtagtgatgggtaactggaaactaaacggcagcaaagcaatggtaact
gagctgctaactggtcttaacgctgagcttgaaggcgttgaaggtgttgacgtagcagtc
gctccaccagcactttacatcgacctagcagagcgcgtaatcgctgaaggcggtaacaag
atcatcctaggtgctcaaaacactgacctaaacaacagcggtgcgttcactggcgatatg
tctccagaaatgctgaaagatttcggtgctactcacatcatcatcggtcactcagagcgt
cgtgaataccacaacgaatctgacgagtttatcgctaagaaattcaacttcctaaaagaa
aacggcctaacacctgttttctgtatcggtgaatctgaagcgcaaaacgaagctggcgaa
actgaagctgtatgtgcacgtcaaatcaacgcagttatcgacacttacggtgttgaagct
ctaaacggcgcaatcatcgcttacgaaccaatctgggctatcggtactggtaaagcagca
acagctgaagatgcacaacgcatccacgcttctatccgtgcactaatcgcagcgaaagac
gaagcagttgcagcacaagtaatcatccaatacggcggttctgttaagccagaaaacgct
gaagcttacttctcacaaccagacatcgacggtgctctagttggcggcgcttctctagac
gcgaaaagcttcgcggcaatcgctaaagcagcggcaaaagcaaaagcttaa

DBGET integrated database retrieval system