KEGG   Vibrio sp. Ex25: VEA_001760Help
Entry
VEA_001760        CDS       T01107                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
vex  Vibrio sp. Ex25
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:vex00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VEA_001760
   01230 Biosynthesis of amino acids
    VEA_001760
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VEA_001760
   00051 Fructose and mannose metabolism
    VEA_001760
   00562 Inositol phosphate metabolism
    VEA_001760
Enzymes [BR:vex01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     VEA_001760
Exosome [BR:vex04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   VEA_001760
  Exosomal proteins of bladder cancer cells
   VEA_001760
  Exosomal proteins of melanoma cells
   VEA_001760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:144305..145075
Genome map
AA seq 256 aa AA seqDB search
MRRPVVMGNWKLNGSKAMVTELLTGLNAELEGVEGVDVAVAPPALYIDLAERVIAEGGNK
IILGAQNTDLNNSGAFTGDMSPEMLKDFGATHIIIGHSERREYHNESDEFIAKKFNFLKE
NGLTPVFCIGESEAQNEAGETEAVCARQINAVIDTYGVEALNGAIIAYEPIWAIGTGKAA
TAEDAQRIHASIRALIAAKDEAVAAQVIIQYGGSVKPENAEAYFSQPDIDGALVGGASLD
AKSFAAIAKAAAKAKA
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgtcctgtagtgatgggtaactggaaactaaacggcagcaaagcaatggtaact
gagctgctaactggtcttaacgctgagcttgaaggcgttgaaggtgttgacgtagcagtc
gctccaccagcactttacatcgacctagcagagcgcgtaatcgctgaaggcggtaacaag
atcatcctaggtgctcaaaacactgacctaaacaacagcggtgcgttcactggcgatatg
tctccagaaatgctgaaagatttcggtgctactcacatcatcatcggtcactcagagcgt
cgtgaataccacaacgaatctgacgagtttatcgctaagaaattcaacttcctaaaagaa
aacggcctaacacctgttttctgtatcggtgaatctgaagcgcaaaacgaagctggcgaa
actgaagctgtatgtgcacgtcaaatcaacgcagttatcgacacttacggtgttgaagct
ctaaacggcgcaatcatcgcttacgaaccaatctgggctatcggtactggtaaagcagca
acagctgaagatgcacaacgcatccacgcttctatccgtgcactaatcgcagcgaaagac
gaagcagttgcagcacaagtaatcatccaatacggcggttctgttaagccagaaaacgct
gaagcttacttctcacaaccagacatcgacggtgctctagttggcggcgcttctctagac
gcgaaaagcttcgcggcaatcgctaaagcagcggcaaaagcaaaagcttaa

DBGET integrated database retrieval system