KEGG   Vibrio sp. Ex25: VEA_001881Help
Entry
VEA_001881        CDS       T01107                                 

Definition
3'(2'),5'-bisphosphate nucleotidase (EC:3.1.3.7)
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
vex  Vibrio sp. Ex25
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:vex00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    VEA_001881
Enzymes [BR:vex01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     VEA_001881
Transfer RNA biogenesis [BR:vex03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    VEA_001881
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:271381..272208
Genome map
AA seq 275 aa AA seqDB search
MPMTKDLSHLLPQVIEIARSAGQMILEIYEKKQYEAYTKSDETPVTSADIAAHKLITERL
SELTPDIPVLSEEDADISLEQRAQWERYWLVDPLDGTQEFIARSGDFATIIALVDNNKPT
MGVVYGPVSGVTYYAYSGKGAWKIPDMSDSVKIHTHKHEQPGQSIAIAISRRQDINRITS
RMSSAWNYDLIPLGSAALKACLVAEGAVDCYLRLGPTGEWDTAATQCIVEEAGGRILSTQ
LEPLSYNERETLENPNFIVLGDADLPWNEILQRKD
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgccaatgacaaaagatctatctcacctgcttcctcaagtcatcgaaattgcccgtagt
gccgggcaaatgatcctcgaaatatatgaaaaaaaacagtacgaggcctacacaaaaagt
gacgagactccggtaacgagcgcagatatcgcggctcacaagctcatcacagaacgcttg
agtgaactcacacccgacattcccgtattgtcagaagaagacgcagacatcagcctcgag
caacgagctcagtgggaacggtattggttagtcgaccctcttgacggtactcaagaattc
atcgctcgcagcggcgactttgcgactattattgcactggtcgacaacaacaaaccaacc
atgggggtcgtttatggccctgtctctggcgtgacttattacgcttatagtggcaaaggt
gcttggaaaattcccgacatgtcggacagcgtaaaaatccatacgcacaaacacgagcag
ccagggcaaagcatcgcgattgctattagccgccgtcaagatatcaatcgcatcactagc
cgcatgagcagtgcttggaattacgatttaattccgctcggctctgcggcattaaaagcg
tgtcttgttgcagaaggcgcggtagattgctatctcagactaggcccaacaggtgagtgg
gacaccgctgcgacacaatgcattgttgaagaagcgggcggtcgcattctcagcacgcaa
ttggagccgctgtcatataacgagcgggaaacgctagagaacccaaactttattgtgctt
ggtgatgcggatttaccttggaatgagattttacaacgcaaagattaa

DBGET integrated database retrieval system