KEGG   Vibrio antiquarius: VEA_001988Help
Entry
VEA_001988        CDS       T01107                                 

Definition
(GenBank) fatty oxidation complex alpha subunit FadB
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
vex  Vibrio antiquarius
Pathway
vex00071  Fatty acid degradation
vex00280  Valine, leucine and isoleucine degradation
vex00281  Geraniol degradation
vex00310  Lysine degradation
vex00362  Benzoate degradation
vex00380  Tryptophan metabolism
vex00410  beta-Alanine metabolism
vex00640  Propanoate metabolism
vex00650  Butanoate metabolism
vex00903  Limonene and pinene degradation
vex00930  Caprolactam degradation
vex01040  Biosynthesis of unsaturated fatty acids
vex01100  Metabolic pathways
vex01110  Biosynthesis of secondary metabolites
vex01120  Microbial metabolism in diverse environments
vex01130  Biosynthesis of antibiotics
vex01200  Carbon metabolism
vex01212  Fatty acid metabolism
Module
vex_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:vex00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    VEA_001988
   00650 Butanoate metabolism
    VEA_001988
  Lipid metabolism
   00071 Fatty acid degradation
    VEA_001988
   01040 Biosynthesis of unsaturated fatty acids
    VEA_001988
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    VEA_001988
   00310 Lysine degradation
    VEA_001988
   00380 Tryptophan metabolism
    VEA_001988
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    VEA_001988
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    VEA_001988
   00281 Geraniol degradation
    VEA_001988
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    VEA_001988
   00930 Caprolactam degradation
    VEA_001988
Enzymes [BR:vex01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     VEA_001988
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     VEA_001988
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     VEA_001988
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     VEA_001988
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 Carboxyl_trans NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: ACY50151
Position
1:397572..399743
Genome map
AA seq 723 aa AA seqDB search
MIYQAETLQVKEIQDGIAELSFCSPKSVNKLDLATLESLDKALDALIAHQGLKGLLLTSD
KDAFIVGADITEFLGLFAKTDAELDQWLQFANSIFNKLEDLPVPTISVIKGHALGGGCEC
VLATDMRIGDKTTSIGLPETKLGIMPGFGGCVRLPRVIGADSAMEIITQGKACRADEALK
IGLLDAVVETDALYESALQTLNSAINEKLDWQARRAQKTSPLTLSKLESMMSFTMAKGLV
AQKAGPHYPAPMTAVITIEEGARFARNEALDIERKHFVKLAKSEEAKSLVGLFLNDQYIK
GIAKKAAKSASKDTQRAAVLGAGIMGGGIAYQSALKGVPVLMKDIAQASLDLGMTEASKL
LNKRLSRGRIDGFKMAGILASITPSLHYAGIENSDVIVEAVVENPKVKAAVLSEVESHVG
DDTVITSNTSTIPINLLAKSLKRPENFCGMHFFNPVHRMPLVEIIRGEHTSDETINRVVA
YAAKMGKSPIVVNDCPGFFVNRVLFPYFGGFSMLLRDGADFTKIDKVMERKFGWPMGPAY
LLDVVGIDTAHHAQAVMAEGFPERMGKQGRDAIDALFEADKYGQKNGNGFYSYTIDKKGK
PKKTFSEAILPVLADVCADKHDFDDETIIQRMMIPMINEVVLCLQEGIIATPQEADMALV
YGLGFPPFRGGVFRYLDSVGIAEYVEMAKQHAELGAMYQVPQMLIDMAAKGESFYGAQQQ
GSI
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atgatttaccaagccgaaaccctacaggtaaaggaaatacaagatggtattgcagagcta
agcttctgctctccaaaatccgtcaacaaactcgacctagcgacattggaatcgctagat
aaagctcttgatgcgctcattgcccatcaaggcctcaaggggttgttgctcacttcagat
aaagacgcattcattgtaggcgcagacattaccgagtttttaggtctgtttgctaaaacg
gatgccgagctcgaccaatggctgcaatttgctaatagcatctttaacaaattagaagac
ttacccgttccgaccatctcagtgatcaaaggccacgctcttggtggcggttgtgaatgt
gtactagcaacagacatgcgtattggtgacaaaaccaccagcatcggcctaccagaaacg
aaactgggaatcatgccaggctttggtggttgtgtacgcttacctcgcgttattggcgca
gacagcgcaatggaaatcatcacccaaggtaaagcatgccgagctgatgaagcattgaaa
attggcttactcgatgctgttgtagagactgatgctttatacgaatcggcactacaaacg
ctgaactctgcaattaacgagaaacttgactggcaagcacgccgagcacagaaaacatct
ccgctaacgctgagtaagcttgaatcaatgatgagcttcaccatggcgaagggtctggtg
gcacaaaaagcaggtcctcattaccctgccccaatgacagccgttatcacgattgaagaa
ggtgctcgctttgcacgtaatgaagcgttagacattgaacgtaagcacttcgtgaaattg
gctaaatcggaagaagcaaaatcactggttggcctattccttaatgatcaatacatcaaa
ggcattgcgaaaaaagcagcgaagtcagcaagtaaagacacgcaacgtgcagccgtatta
ggtgcaggtatcatgggtggcggcattgcttaccaatcagcgctaaaaggtgtgccagtc
ttgatgaaagacatcgcacaagcgtcgctcgacctaggcatgactgaagcatctaagctg
ctgaataaacgcttatctcgcggtcgcattgacggctttaagatggcaggtattttagcg
tcaatcacaccgagcctacattacgcaggtattgaaaactctgatgtgattgttgaagct
gtcgttgaaaacccgaaagtaaaagcagcagttttgagtgaagttgagtcccatgtcggt
gacgacaccgttatcacctcaaacacctcgacgattcctatcaacctattggcaaaatca
ctaaaacgcccagaaaacttctgtggtatgcacttcttcaacccagtgcatcgtatgcct
cttgttgagatcatccgtggtgagcacacctctgatgaaaccatcaatcgtgttgtggcg
tatgctgcgaaaatgggcaaatcaccaattgtcgttaatgactgcccggggttcttcgtt
aaccgcgtattgttcccatactttggcggcttcagcatgctacttcgtgatggtgctgac
tttacgaaaatcgacaaagtcatggagcgtaagtttggctggccgatgggaccggcgtac
ttgcttgatgtagtcggcattgataccgcgcaccacgcacaagctgtgatggcagagggt
ttccctgagcgtatgggtaaacaaggtcgtgatgcgattgatgcactattcgaagcagac
aaatatggtcagaaaaatggtaatggcttctacagctacaccatagataaaaaaggtaag
ccgaagaaaaccttctcagaagcgatcttaccagtacttgccgacgtttgtgctgataag
catgactttgacgatgagaccatcattcaacgtatgatgattccaatgatcaacgaagtt
gtgctgtgccttcaagaaggcatcatcgctactccgcaggaagcagacatggcattggtt
tatggtcttggtttccctccattccgcggtggcgtattccgctatctagacagcgtgggt
attgctgaatacgttgaaatggcaaaacaacacgccgagctaggtgcgatgtaccaagta
ccgcaaatgctgattgatatggcggcgaaaggagaaagcttttacggtgcacaacagcaa
ggttctatctaa

DBGET integrated database retrieval system