KEGG   Vibrio sp. Ex25: VEA_002041Help
Entry
VEA_002041        CDS       T01107                                 

Definition
acetolactate synthase large subunit (EC:2.2.1.6)
Orthology
K01652  
acetolactate synthase I/II/III large subunit [EC:2.2.1.6]
Organism
vex  Vibrio sp. Ex25
Pathway
Valine, leucine and isoleucine biosynthesis
Butanoate metabolism
C5-Branched dibasic acid metabolism
Pantothenate and CoA biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:vex00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    VEA_002041
   01230 Biosynthesis of amino acids
    VEA_002041
  Carbohydrate metabolism
   00650 Butanoate metabolism
    VEA_002041
   00660 C5-Branched dibasic acid metabolism
    VEA_002041
  Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    VEA_002041
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    VEA_002041
Enzymes [BR:vex01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     VEA_002041
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(449528..450793)
Genome map
AA seq 421 aa AA seqDB search
MTEIEDLAPTLAEAFEVAKTGRPGPVIVDIAKDVQLAQTPTDLLPPYVAPAIEDVSAEDI
KRAQDVLAASTRPVLYVGGGVQLAKATDAVREFLRLNPMPAVSTLKGLGTIERHDPHYLG
MLGMHGTKAANLVVQEADLLIVVGARFDDRVTGKLDTFAPNAKVIHIDIDAAEIHKLRHA
NAPLRGDINTILPQLELTQDISPWVHHSESLRSGFKWRYDHPGELIYAPLLLKQLSDMMP
DSSIVSTDVGQHQMWAAQHIQPREPQNFITSAGLGTMGFGLPAAMGAAVARPDDQSILIT
GDGSFMMNVQELGTLKRRQIPVKIVLLNNQRLGMVRQWQSLFFDGRHSETILDDNPDFVM
LAKAFDIPGKTITKKEEVEPALKEMLASETSYMLHVLIDEEENVWPLVPPGASNSDMLEN
T
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgaaattgaagacctagcgccaacgctagccgaagcgtttgaagtggccaaaacg
ggtcgtccgggtccagtcattgtcgatatcgccaaagacgttcaactggctcaaacccca
acagatctactgcctccatacgtagcgcctgcaatcgaagatgtcagcgctgaagacatt
aagcgcgcacaagatgtactggcagcctcaactcgcccagtgttgtatgttggtggtggc
gtgcaactcgctaaagcaaccgatgcagtacgcgaattccttcgcttaaacccaatgcca
gcagttagcacactaaaaggcctcggtaccattgaacgccatgaccctcactatcttggt
atgttgggcatgcacggcaccaaagccgctaacctagtggttcaagaagccgatctattg
atcgtggttggcgcacgctttgatgaccgtgtgacgggtaagctcgacacgtttgcacca
aatgcgaaagtgattcacatcgacattgatgctgcggagattcataaactgcgccacgcc
aacgcaccattgcgtggcgacatcaacaccattcttcctcagctagagctgactcaagat
atctcaccgtgggtacatcacagtgaaagtctgcgtagcggctttaagtggcgttacgac
cacccgggcgagttaatctacgcaccgctattgcttaaacaactgtcagacatgatgcca
gacagctcaattgtctcgactgatgtaggtcagcaccagatgtgggcagcgcaacatatc
cagccacgcgaaccacaaaatttcatcacttctgctggccttggcaccatgggctttggc
ttgccagcagcgatgggtgcagcagtcgcacgtcctgatgatcagtctatccttattaca
ggtgacggttcatttatgatgaacgtgcaggaattgggcacgctgaagcgtcgtcagatt
ccagtgaagattgtccttcttaataaccaacgtcttggcatggttcgccaatggcagtca
ttgttctttgacggccgccacagcgaaaccattcttgatgacaacccagacttcgtgatg
cttgccaaagcgttcgatatcccgggcaaaaccatcaccaagaaagaagaagtcgaacct
gctctcaaagagatgctagcgagtgaaacttcttacatgcttcacgttttgattgatgaa
gaagaaaacgtgtggccattggtgccacctggcgcatcaaacagtgatatgttggaaaat
acatag

DBGET integrated database retrieval system