KEGG   Vibrio sp. Ex25: VEA_002105Help
Entry
VEA_002105        CDS       T01107                                 

Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
vex  Vibrio sp. Ex25
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:vex00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(527050..527778)
Genome map
AA seq 242 aa AA seqDB search
MAVLVTRPGEQGNALCSLLERHGISAYHHPLIDIVADLTDTHLSKHLHQAQIVIAVSRHA
VQCAQQILASNGMSWPKQAIYLAVGQKTAHYLSKCTQQKVHYPQVSDSEHLLRLPELNNV
AQQQVLILRGNGGRELIKDALVRRGAKVHYSETYKREFIPFDPVSCVSLWKTLQIDQIIV
TSGEQLDYLCSQLTSEQLTWLNQQELYIPSQRIADIALQRGFTRVRCTGSASNQELLAAL
QP
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atggcagtgttggtcactcggccgggagagcaaggcaacgcgctttgctctctgctcgaa
aggcacggcatttccgcatatcaccatcctctgatcgacattgtcgccgatctcacggac
acgcacctctctaaacatctacatcaagctcaaattgttatcgctgttagtcgacatgca
gtgcaatgtgcacagcaaatcttagccagcaacgggatgtcatggccgaaacaagccatt
taccttgccgttggtcaaaaaacagcacactatttaagcaaatgtacccaacagaaagta
cactatccccaagtcagtgatagtgaacacttattgcgactgccagagctcaacaatgtg
gcccaacaacaagttcttatccttcgtggtaacggcggaagagagctgatcaaagatgca
ttggtgagacgtggcgcaaaagttcactatagtgagacttacaagagagaattcatccca
ttcgatccagtaagctgtgtctcactatggaaaaccctacaaattgaccagatcatcgtc
accagtggtgagcaactggattatttgtgcagccaattgacgtcagagcaattgacttgg
cttaatcaacaagagttgtatatccccagtcagcgtatcgctgacatcgcacttcaaagg
gggttcactcgggtgagatgcacgggaagcgcatccaaccaagaattactggcggctctc
cagccctag

DBGET integrated database retrieval system