KEGG   Vibrio antiquarius: VEA_002222Help
Entry
VEA_002222        CDS       T01107                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
vex  Vibrio antiquarius
Pathway
vex00010  Glycolysis / Gluconeogenesis
vex00030  Pentose phosphate pathway
vex00051  Fructose and mannose metabolism
vex00052  Galactose metabolism
vex00680  Methane metabolism
vex01100  Metabolic pathways
vex01110  Biosynthesis of secondary metabolites
vex01120  Microbial metabolism in diverse environments
vex01130  Biosynthesis of antibiotics
vex01200  Carbon metabolism
vex01230  Biosynthesis of amino acids
vex03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:vex00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VEA_002222
   00030 Pentose phosphate pathway
    VEA_002222
   00051 Fructose and mannose metabolism
    VEA_002222
   00052 Galactose metabolism
    VEA_002222
  Energy metabolism
   00680 Methane metabolism
    VEA_002222
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    VEA_002222
Enzymes [BR:vex01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     VEA_002222
Protein phosphatases and associated proteins [BR:vex01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     VEA_002222
Messenger RNA biogenesis [BR:vex03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     VEA_002222
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat Peripla_BP_1
Motif
Other DBs
NCBI-ProteinID: ACY50385
Position
1:669711..670673
Genome map
AA seq 320 aa AA seqDB search
MIKKIGVLTSGGDAPGMNAAIRGVVRTALSEGLEVFGVYDGYLGLYEGRIEKLDRSSVSD
VINKGGTFLGSARFPEFKEVEVREKAIENLKKHGIDALVVIGGDGSYMGAKKLTEMGYPC
IGLPGTIDNDIAGTDYTVGYLSALNTVIDAIDRLRDTSSSHQRISIVEIMGRHCGDLTLM
SAIAGGCEYIITPETGLDKDKLISNIQDGIAKGKKHAIIALTELMMDANELARDIEAATG
RETRATVLGHIQRGGRPTAFDRVLASRMGNYAVHLLIEGHGGRCVGIVKEQLVHHDIIDA
IENMKRPVRNDLYKVAEELF
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgattaagaagatcggtgttttaacaagtggcggtgacgcacctggtatgaacgcggcg
atacgcggcgtagtacgtacagcactatccgagggattggaagtattcggtgtgtacgac
ggctacctaggcctatacgaaggccgcatcgagaagctagatcgttctagcgtttcagat
gtgatcaacaaaggtggtacgttcctaggttctgcacgtttccctgaatttaaagaagtg
gaagtgcgtgaaaaagcgattgagaacctgaaaaaacatggtatcgatgcgctagtcgtg
atcggtggtgacggttcgtacatgggtgcgaagaaactgactgaaatgggttacccatgt
atcggtctaccaggcacaatcgacaacgatatcgctggtactgactacacagtgggctac
ctaagtgcactaaacacagttatcgatgcgatcgaccgtctacgtgatacttcttcatct
caccaacgtatttcaattgtagaaatcatgggtcgtcactgtggtgacctaactctgatg
tctgcaatcgcgggtggttgtgagtacatcatcactccagaaactggcctagacaaagac
aagctgatcagcaacatccaagacggcattgcaaaaggtaagaaacacgcaatcatcgcg
ttgactgagctaatgatggatgccaatgaactggctcgtgacatcgaagcggcgacaggt
cgtgaaactcgtgcaacagtacttggtcacatccaacgtggtggtcgtccaacggcattt
gaccgcgttctagcatctcgtatgggtaactacgctgttcacctattgatcgaaggtcat
ggtggtcgttgtgtcggtatcgtgaaagagcaacttgttcaccacgacatcatcgacgcg
atcgaaaacatgaagcgtccagtacgcaacgatctatacaaagttgctgaagaactgttc
taa

DBGET integrated database retrieval system