KEGG   Vibrio sp. Ex25: VEA_002222Help
Entry
VEA_002222        CDS       T01107                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
vex  Vibrio sp. Ex25
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:vex00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VEA_002222
   01230 Biosynthesis of amino acids
    VEA_002222
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VEA_002222
   00030 Pentose phosphate pathway
    VEA_002222
   00051 Fructose and mannose metabolism
    VEA_002222
   00052 Galactose metabolism
    VEA_002222
  Energy metabolism
   00680 Methane metabolism
    VEA_002222
Enzymes [BR:vex01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     VEA_002222
Protein phosphatases and associated proteins [BR:vex01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     VEA_002222
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:669711..670673
Genome map
AA seq 320 aa AA seqDB search
MIKKIGVLTSGGDAPGMNAAIRGVVRTALSEGLEVFGVYDGYLGLYEGRIEKLDRSSVSD
VINKGGTFLGSARFPEFKEVEVREKAIENLKKHGIDALVVIGGDGSYMGAKKLTEMGYPC
IGLPGTIDNDIAGTDYTVGYLSALNTVIDAIDRLRDTSSSHQRISIVEIMGRHCGDLTLM
SAIAGGCEYIITPETGLDKDKLISNIQDGIAKGKKHAIIALTELMMDANELARDIEAATG
RETRATVLGHIQRGGRPTAFDRVLASRMGNYAVHLLIEGHGGRCVGIVKEQLVHHDIIDA
IENMKRPVRNDLYKVAEELF
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgattaagaagatcggtgttttaacaagtggcggtgacgcacctggtatgaacgcggcg
atacgcggcgtagtacgtacagcactatccgagggattggaagtattcggtgtgtacgac
ggctacctaggcctatacgaaggccgcatcgagaagctagatcgttctagcgtttcagat
gtgatcaacaaaggtggtacgttcctaggttctgcacgtttccctgaatttaaagaagtg
gaagtgcgtgaaaaagcgattgagaacctgaaaaaacatggtatcgatgcgctagtcgtg
atcggtggtgacggttcgtacatgggtgcgaagaaactgactgaaatgggttacccatgt
atcggtctaccaggcacaatcgacaacgatatcgctggtactgactacacagtgggctac
ctaagtgcactaaacacagttatcgatgcgatcgaccgtctacgtgatacttcttcatct
caccaacgtatttcaattgtagaaatcatgggtcgtcactgtggtgacctaactctgatg
tctgcaatcgcgggtggttgtgagtacatcatcactccagaaactggcctagacaaagac
aagctgatcagcaacatccaagacggcattgcaaaaggtaagaaacacgcaatcatcgcg
ttgactgagctaatgatggatgccaatgaactggctcgtgacatcgaagcggcgacaggt
cgtgaaactcgtgcaacagtacttggtcacatccaacgtggtggtcgtccaacggcattt
gaccgcgttctagcatctcgtatgggtaactacgctgttcacctattgatcgaaggtcat
ggtggtcgttgtgtcggtatcgtgaaagagcaacttgttcaccacgacatcatcgacgcg
atcgaaaacatgaagcgtccagtacgcaacgatctatacaaagttgctgaagaactgttc
taa

DBGET integrated database retrieval system