KEGG   Vibrio sp. Ex25: VEA_002415Help
Entry
VEA_002415        CDS       T01107                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
vex  Vibrio sp. Ex25
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:vex00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:vex00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:885851..887116
Genome map
AA seq 421 aa AA seqDB search
MEKFRVIGSDKPLVGEVTISGAKNAALPILFASILAEEPVEVANVPHLRDIDTTMELLKR
LGAKVSRNGSVHVDPSRITEYCAPYDLVKTMRASIWALGPLVARFGQGQVSLPGGCAIGA
RPVDLHISGLEQLGATITLEDGYVKAEVDGRLKGAHIVMDKVSVGATITIMCAAALAEGT
TTLDNAAREPEIVDTADFLNKLGAKISGAGTDTITIEGVERLGGCKHNVVADRIETGTFL
VAAAVSGGKVVCRNTNAHLLEAVLAKLEEAGALVETGEDWISVDMTARELKAVSVRTAPH
PGFPTDMQAQFTLLNMMAKGGGVITETIFENRFMHVPELMRMGAKAEIEGNTVICGDVES
LSGAQVMATDLRASASLVIAGCIAKGETIVDRIYHIDRGYDKIENKLAALGANIERVSEA
S
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagtttcgagttattgggtcagataaaccactcgttggtgaagtgaccatttcc
ggtgcaaaaaacgcagcactgccgattttatttgcgtctatcttggcggaagagcctgta
gaagtggcaaacgtgccacaccttcgtgatatcgatacaaccatggaactgcttaagcgt
ttaggcgcgaaagtaagccgtaatggttctgttcacgtcgatccaagtcgcattactgaa
tactgcgcaccgtatgatttggtgaaaaccatgcgtgcttctatttgggctttgggcccg
ctcgtagcgcgatttggtcaaggtcaggtttctctacctggcggttgtgctatcggtgct
cgtcctgttgatctgcatatttctggcctagagcagcttggcgcaacgattacgcttgaa
gatggttacgttaaagctgaggttgatggtcgtctaaaaggtgcgcacatcgtgatggat
aaagtcagcgtaggcgcgacgatcaccatcatgtgtgctgcagcacttgctgaaggcact
acaacgctagacaacgcggcgcgtgaacctgaaattgtagacaccgcggatttcctaaat
aagcttggtgcaaaaatttctggtgcaggtacagatacgatcacgattgaaggtgttgag
cgcctaggtggttgtaaacacaacgtagttgccgaccgtattgagacaggaacattcctt
gtcgctgccgcggtatctggtggtaaagtagtatgtcgtaacactaacgctcatttgctt
gaagcggttttagccaagctagaagaagctggcgcgcttgtcgaaacgggtgaagattgg
atttcagttgatatgactgctcgcgagctgaaagcagtgagtgtacgtacagcgccgcat
ccaggcttcccgaccgatatgcaagcgcaatttacgctactaaacatgatggcgaaaggc
ggcggcgtgatcactgagactatctttgaaaaccgctttatgcacgtaccagaactcatg
cgtatgggcgcgaaagccgagattgaaggcaacaccgttatctgtggtgatgttgagtca
ttaagtggtgcgcaagtgatggcaaccgacctacgagcttcggctagtttggtaattgcg
ggctgtattgctaaaggcgaaaccatcgttgatcgtatttaccatatcgaccgcggttac
gacaaaatcgaaaataaactggctgcacttggcgcaaatattgagcgagtgagcgaggca
agttaa

DBGET integrated database retrieval system