KEGG   Vibrio sp. Ex25: VEA_002562Help
Entry
VEA_002562        CDS       T01107                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
vex  Vibrio sp. Ex25
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:vex00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    VEA_002562
Enzymes [BR:vex01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     VEA_002562
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1052601..1053086)
Genome map
AA seq 161 aa AA seqDB search
MITAYIAVGSNLADPVSQAKQAIEALKTLPKSEFVQASSLYSSTPMGPQNQPDYINAVVS
INTSLTPLELLDCTQAIEQEQGRVRKDERWGPRTLDLDIVLYGNEVINSERLIVPHYGMK
EREFVLYPLAEIAPSLQLPDGTEVSKLLEQVDRNGLSIWQS
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgatcacagcgtacattgcggtaggcagtaacttggctgatcctgtcagccaagcgaag
caagcgattgaagcgttaaaaacgctgcctaaatcagaatttgttcaggcttcttcgcta
tacagcagcacgccaatgggaccacaaaaccaaccggattacatcaatgcggttgtgtcg
attaacaccagtttgacgcctcttgagttgctcgattgcacacaagccattgagcaagaa
caagggcgtgtccgtaaagacgaacgttggggaccaagaaccttggacctcgacattgtt
ctttatggcaatgaggtgattaattccgagaggctgatcgttcctcattatggaatgaaa
gagcgtgaattcgtactctaccctcttgcggaaattgcaccaagtttacaactccccgat
gggaccgaggtctctaaactactggaacaagtagatagaaacggcctcagtatctggcag
tcatag

DBGET integrated database retrieval system