KEGG   Vibrio sp. Ex25: VEA_002604Help
Entry
VEA_002604        CDS       T01107                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
vex  Vibrio sp. Ex25
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:vex00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    VEA_002604
Enzymes [BR:vex01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     VEA_002604
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1111930..1112709
Genome map
AA seq 259 aa AA seqDB search
MAILNVTPDSFSDGGKYNSIELALAQVDKMIKAGVSIVDVGGESTRPGAPDVSLEEELRR
VVPVIKAIREKYDVWISIDTSKAEVMRQAIDAGADLINDIRSLQEPGALEVAAEAKLPIC
LMHMKGQPRTMQIAPHYDDVMSDVSAFLEERIAACEAAGIDKSQLILDPGFGFGKTIEHN
YHMLAHLEKFHEFGLPILAGMSRKSMIFKLLDKPAAECTNASVVCATIAAMKGAQIIRVH
DFEETIEAMKVVEMTKNNI
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggccattctaaatgtgactccggattccttttcggatggtggtaaatacaactcgatt
gaactcgcccttgctcaagttgataaaatgataaaggctggggtaagcattgttgatgtt
ggtggggagtcgacaaggcctggcgcgccagatgtgtctttagaagaagaacttcgacgt
gttgtcccagtaatcaaggccattcgtgaaaagtacgatgtgtggatttcgatcgatacc
agtaaagcggaagttatgcgtcaagctattgatgctggtgcagatttgatcaatgacatt
cgatctttgcaagaacctggtgctctcgaagtcgcagcagaagcaaagcttccaatttgt
ctgatgcatatgaaaggtcaacctagaaccatgcaaattgcacctcattatgatgatgtg
atgagcgacgtatctgcctttctagaagaacgtatcgcggcatgtgaagcagcagggatt
gataaatctcaactgattctcgatcctggatttggctttggcaaaacgatagaacacaat
tatcatatgctcgctcatcttgaaaagtttcatgaattcggcctgccaattttggctggc
atgtctcgtaaatcaatgatttttaaattgttggataagcctgcggctgaatgtacaaat
gcgagtgtcgtttgcgctacgattgcagcaatgaaaggcgcgcagatcattcgtgtgcat
gactttgaagagacaatcgaagcaatgaaagttgttgagatgacgaaaaacaatatttaa

DBGET integrated database retrieval system