KEGG   Vibrio sp. Ex25: VEA_002623Help
Entry
VEA_002623        CDS       T01107                                 

Definition
DNA polymerase III psi subunit (EC:2.7.7.7)
Orthology
K02344  
DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
vex  Vibrio sp. Ex25
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:vex00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    VEA_002623
   00240 Pyrimidine metabolism
    VEA_002623
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    VEA_002623
   03430 Mismatch repair
    VEA_002623
   03440 Homologous recombination
    VEA_002623
Enzymes [BR:vex01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     VEA_002623
DNA replication proteins [BR:vex03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     VEA_002623
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1133370..1133780
Genome map
AA seq 136 aa AA seqDB search
MSINEKQYLHEMGISTWELVHPDRLAGYQSPKIDLQSSCKLLLISPVCPENETAVLFENI
LKSMKLTLDQALHIEPERFPLLGQHELEWVWFAGCEAEVLPDTKPLTSPLLQDVDGNTQQ
KRALWQQICSYNNSSK
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atgtcaattaacgagaaacagtatttacacgaaatgggcatcagcacatgggagctggta
cacccagatagattggcaggttaccaatcgccaaaaatcgatttgcaaagttcttgcaaa
ctcctgttgatctctccggtatgtccagagaatgagacggcggttttgtttgaaaacatc
ctaaagagtatgaagttaacgcttgaccaagcgttacatattgagccagagcgatttcca
ttacttggccagcacgagcttgagtgggtttggtttgcagggtgtgaagccgaagtattg
cctgacactaaaccgctgacatcgccattgttgcaagatgtggatgggaatacccaacaa
aaacgtgcactttggcaacagatttgttcttacaacaattcgagcaaataa

DBGET integrated database retrieval system