KEGG   Vibrio sp. Ex25: VEA_002630Help
Entry
VEA_002630        CDS       T01107                                 

Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
vex  Vibrio sp. Ex25
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vex00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    VEA_002630
Enzymes [BR:vex01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     VEA_002630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1140024..1141352
Genome map
AA seq 442 aa AA seqDB search
MYLPQEIIRKKRDGEVLTADEINFFIQGVANNTVSEGQIAAFAMTIFFNEMTMDERIALT
CAMRDSGMVIDWSHMNFGGPIVDKHSTGGVGDVTSLMLGPMVAACGGFVPMISGRGLGHT
GGTLDKLESIPGYNITPSNDVFGQVTKDAGVAIIGQTGDLAPADKRVYATRDITATVDNI
SLITASILSKKLAAGLESLVMDVKVGSGAFMPTYEASEELAKSIVAVANGAGTKTTAILT
DMNQVLASSAGNAVEVREAVRFLTGEYRNPRLLEVTMASCAEMLVLGKLAENTEDARAKL
MEALDNGKAAACFGKMVAGLGGPADFVENYDNYLEKAEVIKPVYATETGIVSAMDTRAIG
MAVVAMGGGRRVATDEIDYAVGFDEFIRLGEVADSDKPLAVIHARSEEQWEEAAKALRSA
IKVGGEYTPTPEVYRQIRAEDI
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgtatttaccacaagaaatcattcgtaaaaaacgtgacggtgaagtacttaccgcagac
gaaatcaacttctttattcaaggcgtagcaaataacaccgtatctgaaggtcagatcgcg
gcgtttgctatgacgattttcttcaatgaaatgaccatggatgagcgcatcgccctaacg
tgtgcaatgcgtgattcgggcatggttatcgactggagccacatgaactttggtggccca
attgtcgacaaacactctaccggcggtgtgggtgacgtaacgtctttgatgcttggccct
atggtggcagcatgcggcggtttcgtaccaatgatctctggccgtggtcttggccacaca
ggcggtacgctagataagcttgagtctattccaggctacaacatcacaccaagcaacgat
gtgtttgggcaagtaactaaagatgcaggtgtggcgatcatcggtcaaactggtgacctt
gctccagcggataagcgtgtttacgcgactcgtgatattaccgcaaccgtagacaacatt
tctctgatcacggcttccattctttctaagaaattggcggcgggtctggagtcgctagtg
atggacgttaaagtcggctctggtgcattcatgccaacttacgaagcgtctgaagagcta
gcaaaatcaatcgttgcagtagcaaacggtgcgggtactaagaccactgcaatcctgaca
gacatgaaccaagtattggcctcttcggcaggtaatgcggtggaagttcgtgaagcagtt
cgtttcctaacgggtgaataccgtaacccacgcctacttgaagtcaccatggcttcttgt
gcagaaatgctggtacttggcaaactggctgagaacacagaagacgcacgtgcgaaattg
atggaagcactagacaacggcaaagcagcagcatgcttcggtaagatggttgcgggtctt
ggcggcccagcagacttcgtagaaaactacgataactacctagaaaaagcggaagtcatc
aagcctgtttacgcgactgaaacgggcattgtttcagcaatggacacgcgtgcgattggc
atggctgtcgttgctatgggtggtggtcgccgtgttgctactgatgaaatcgactatgcc
gtaggtttcgacgagttcatccgcttgggtgaagttgcagatagcgataaacctcttgcc
gttatccacgctcgcagtgaagagcagtgggaagaagcggcaaaagcactgcgcagtgca
atcaaagtaggtggtgagtacacaccaactccagaggtttaccgccaaattcgtgcagaa
gatatttaa

DBGET integrated database retrieval system