KEGG   Vibrio sp. Ex25: VEA_002658Help
Entry
VEA_002658        CDS       T01107                                 

Definition
beta-D-galactosidase subunit alpha
Orthology
K12111  
evolved beta-galactosidase subunit alpha [EC:3.2.1.23]
Organism
vex  Vibrio sp. Ex25
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vex00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    VEA_002658
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    VEA_002658
Enzymes [BR:vex01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     VEA_002658
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1173816..1176914)
Genome map
AA seq 1032 aa AA seqDB search
MNNWENFQHLHENRMAPRAYFFSYDSVQSAQTFQRELSRRFMLLSGQWTFRYFTNPMLVP
DEFYSQTMNGWGHITVPNMWQMEGHGDLQYTDEGFPFPIDVPFVPTDNPTGAYQRTFTLG
PQWGNQQTIIKFDGVETYFEVYINGEYVGFSKGSRLTAEFDISKFVQQGENLLSVRVMQW
ADSTYIEDQDMWWTAGIFRDVYLIGKENIHVQDLTIRTDFADDYQSATLSAQIELENLST
AIASGYTLEYALHDKGTVVASGQCDSLTIQNHHSTSFAIDMVSPTHWTAENPYLYHLFIT
LKDHQGNVVEVIPQRVGFRDIKVRDGLFYINNQYVMLHGVNRHDNDHLKGRAVGMDRVEK
DLILMKQHNINSVRTAHYPNDPRFYELCDIYGLFVMAETDVETHGFANVGDLSRITNDPA
WEAVFVDRAVRHVHAQKNHPSIIMWSLGNESGYGCNIRAMYTATKAIDNTRLVHYEEDRD
AEVVDVISTMYSRAQLMNYFGEHPHEKPRIICEYAHAMGNGPGGLTEYQNVFYAHDHIQG
HYVWEWCDHGILARDEHGQEFYKYGGDYGDYPNNYNFCMDGLIYPDQTPGPGLKEYKQVI
APVKIRAVEGCHDRFIVENKLWFTNLDDYTITADVRAEGETLHSVQFKVKALVANSEREV
TIDLPELDEREAFVNFTVRKDSRTLYSEANHEIAVYQFQLKENTATLPALVNHNIQPLVL
EESRLEHVITGHNFALTFSKVNGKLTSWRVNGEEIIQSEPRLNFFKPMIDNHKQEYEGLW
HPAHLQIIQEHFRTLAVEATYDSVLITTTSIIAPPVFDFGMRCTYRYQINAQGHLNVELS
GERYGDYPHVIPVIGLDLGINGSFDQVSYYGRGPEENYQDSRQANLIDVYHTNVADMFEN
YPLPQNNGNRQHVRWASLTNRHGTGLLVKPQQEINFSAWFYTNQNLHEAQHTIELEKSGY
ITLNLDHQVMGLGSNSWGSEVFDSYRVYMDEFRYGLTLMPLQAGDCNAQVMANHDFDNAF
FTQTNTQSVNEA
NT seq 3099 nt NT seq  +upstreamnt  +downstreamnt
gtgaacaattgggaaaacttccaacacttacacgagaatcgtatggcaccgcgtgcgtac
tttttctcctacgactctgttcagagcgcacaaacctttcaacgtgaactgagtcgccgc
tttatgttgctcagcggccaatggacattccgttatttcaccaacccaatgttggtacct
gatgagttttactcacaaacaatgaacggctggggacacattaccgtcccaaacatgtgg
caaatggaaggccacggcgatctgcaatacaccgatgagggcttcccattcccgatcgac
gtcccgtttgtaccaaccgacaacccaacgggcgcttatcaacgcacatttacacttggt
ccacagtggggtaaccaacaaaccatcatcaagttcgacggcgtggaaacctactttgaa
gtgtacataaacggcgagtacgtcggctttagtaaaggcagccgactcacagcggaattc
gacatttccaagttcgtccaacaaggcgaaaacttactctctgtacgcgtgatgcagtgg
gccgattccacttacattgaagaccaagacatgtggtggacggcggggatattccgtgat
gtttacctaatcggaaaagagaacattcacgtccaagacctaacaattcgcaccgatttc
gccgacgattaccaaagtgcgacgctcagtgctcaaatcgaattggaaaacctttccacc
gctatcgcgtctggctatacgctggaatacgcgctgcatgacaaaggcactgtcgtagcc
agtggtcaatgcgattcactgactatccaaaaccaccactcaacaagctttgcgattgat
atggtgagcccaacgcattggacggctgaaaatccttacctttaccacttgttcattacc
ttaaaagatcaccaaggcaacgtagtggaagtgatcccacaacgcgtgggtttccgtgat
atcaaggtgcgtgatggcctgttttacatcaacaatcaatacgtgatgctgcatggtgtc
aaccgtcatgacaacgaccacctaaaaggtcgcgcagtgggcatggaccgagtggaaaaa
gatctgattttgatgaagcaacacaacatcaactcagttcgcaccgcacactacccgaac
gacccacgcttctacgagttgtgtgatatttacggcctgtttgtgatggcagaaaccgat
gtggaaacccacggctttgccaacgttggcgacctgagccgtatcaccaatgatccagca
tgggaagcggtgtttgttgatcgcgcagtgcgccatgtgcacgcacagaaaaaccaccca
tcgatcatcatgtggtcactcggtaacgaatcgggttatggctgtaacatccgagcgatg
tataccgcgaccaaagcaattgataacacccgtttagttcactacgaagaagaccgcgac
gctgaagtcgtcgatgtgatttcgacgatgtactcacgcgctcaactgatgaattacttt
ggcgagcacccacacgagaagccacgcattatctgcgaatacgcacacgcgatgggcaat
ggaccaggtggtttaaccgaatatcaaaatgtgttctatgcgcacgaccacattcaaggt
cactacgtttgggaatggtgtgatcacggcattctagcgcgtgatgaacacggccaagag
ttctacaaatacggcggcgattacggtgactacccaaacaactacaacttctgtatggat
ggtctgatttacccagatcaaaccccgggcccaggcctgaaagagtacaaacaagtcatt
gcaccggtgaaaatccgcgccgttgaaggttgccatgaccgcttcatcgttgagaacaaa
ttgtggttcaccaacctcgatgattacaccattactgctgacgtgcgtgccgaaggtgaa
accctgcatagcgtgcaattcaaagtcaaagctttggtcgccaacagcgaacgtgaagtg
accatcgacttgccagaattggatgaacgcgaagcctttgttaacttcaccgtacgcaaa
gacagtcgcacgctttacagcgaagccaaccatgaaattgcggtgtatcagttccaactg
aaagaaaacaccgcgacgttgcctgcgctggtcaaccacaatattcaacccttggtgctt
gaagaaagccgcctagagcacgtgatcacaggtcataacttcgcgcttactttctcgaaa
gtaaacggcaagctgacttcttggcgcgtaaatggcgaagagatcattcaatcagagccg
agactgaacttcttcaaaccgatgattgataaccacaaacaagagtatgaaggtttgtgg
cacccagcgcatctgcaaatcatacaggagcacttccgcacacttgctgtggaagcaact
tatgattccgtcttgattacgaccaccagcatcattgcgccgccggtctttgattttggc
atgcgttgtacctatcgctatcaaatcaatgctcaaggccatttgaacgtggaactgagt
ggcgagcgctacggcgactatcctcacgtgattccggtcatcggcttggatttgggcatc
aacggcagctttgatcaagtgagttactacggtcgcggccctgaagagaactatcaagac
agccgccaagctaacctcattgatgtttaccacaccaatgtggcggacatgttcgagaac
tacccgctcccgcaaaacaacggcaaccgccaacacgtgcgctgggcctcactcaccaac
cgtcatggcacagggttattggtgaaacctcagcaagaaatcaacttcagcgcgtggttc
tacaccaaccaaaatctgcatgaagcgcaacatacgatcgagctagaaaagagtggctac
atcacccttaaccttgaccatcaagtgatgggattgggctcgaactcatggggcagcgaa
gtgttcgactcttaccgcgtgtacatggacgagttccgttacggtttgacgctgatgcca
ctgcaagcaggcgattgcaacgcacaagtgatggcaaaccatgatttcgacaacgcgttt
ttcactcaaaccaatactcaatcagtcaacgaggcgtaa

DBGET integrated database retrieval system