KEGG   Vibrio sp. Ex25: VEA_002686Help
Entry
VEA_002686        CDS       T01107                                 

Definition
exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
vex  Vibrio sp. Ex25
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:vex00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    VEA_002686
Enzymes [BR:vex01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     VEA_002686
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1214579..1216726
Genome map
AA seq 715 aa AA seqDB search
MTTNHNLHSDQDSLLVVLERLAHKGALRQLDYQFACFIDSQTNDEQPDNQALAFIAGVVS
SELGKGHICLSLFDAQGQSTDLASKLGLFGESALALNTQLQGIDWIEVLQNSSVVGAQGE
ALPLMFDGERLYLHRYWHYEVTLAEKLNQLGAAVNLQPQEFVRLSELLNHLFARQYHFLF
NALGKAVEAGSSNQVLRQQLVCDHLDVVASESLDWHAIDSVLSNARKVQDLQTLDELVPL
SACVNWQKVAAAVALTRRFAVISGGPGTGKTTTVTKLLAALIEQATHEKNLTIKLVAPTG
KAAARLTESIGKAVQELPVSPELKAKIPTESSTLHRLLGAIPNSAEFRHNKQNPLHLDIL
VIDEASMVDLPMMYKVVDALPKHARLILLGDKDQLASVEAGAVLGDICSFHALGYGKEQA
SAIAKLTGFDTLAHTGNSASSIADSLCMLQKSYRFDARSGIGQLAKAVNSGSAASVDNVW
ARDFSDIEHFALSSQHYNQMMQTLVQEYGRYLKRIGQQETDPKTGEPESLTHKAKAVLDT
FNQCRLLCAIREGDFGVAGLNQRIEKALAARKLIQVQDEIWYHGRPVMVTRNDHGLGLYN
GDIGICMRDDSEEEPRLKVFFELPDGSVKSVLPSRVPEHETAYAMTIHKSQGSEFDYTLM
ILPPDFSPILTRELIYTGITRAKKRLALYAELNVLKRGIKVKTTRASGLVQRLTN
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atgacgacaaatcacaatcttcattctgaccaagatagcctattggtagtgttggaacgc
ttggcgcacaaaggcgcgcttcgtcagctcgactaccaattcgcctgctttattgattct
caaactaatgatgaacagcctgacaaccaagcattggcgtttatcgcgggtgttgtcagt
agtgagcttggcaaaggacatatctgtctgtctctgttcgatgcacaagggcaatctacg
gatttagccagtaagctagggctgtttggtgagtcggcattggcgctcaacacacagttg
caaggcatagactggattgaagtattacaaaattccagcgtggtcggcgcgcaaggagaa
gccttgcctttaatgttcgatggtgagcgtctgtatctgcaccgctattggcattatgaa
gtgacactggcggaaaagctcaatcagttgggcgccgcagttaacttgcaaccacaagag
tttgtgcgattatccgagttgctcaaccatctgtttgcgcgccaataccattttctattt
aacgcgttaggcaaagcagtagaagcgggaagcagcaatcaagtgttgcgtcagcaattg
gtgtgtgaccaccttgatgtggtcgcaagcgaatcgttggattggcacgccattgattcc
gtgcttagcaatgcgcgcaaggttcaggatttgcaaacactggatgaactcgtaccactc
tcagcttgtgtgaactggcaaaaagtcgcggcggcggttgcgttaactcgtcgatttgct
gtgatttctggtggtcctggtacgggtaaaacgacgacagtaaccaaattgcttgctgct
ttgattgaacaggcgacgcacgagaaaaatctaaccatcaagctggtggccccgacgggg
aaagcggcggcgcgattaaccgagtccattggtaaagcagtgcaagaactgccagtttct
ccggagctaaaagccaaaattccgactgaatcgagcaccttgcatcgattacttggcgcg
attcctaatagcgcagaatttcgtcacaacaagcaaaatccactgcatttggatatttta
gttatcgacgaagcgtcgatggtcgatttaccgatgatgtacaaagtggtcgatgcctta
ccgaaacatgcgcggctgattttgttaggtgataaagaccaacttgcctcagttgaagca
ggggcagtgttgggtgatatctgttcgttccatgcattgggttatggcaaagagcaggcg
tcagccatcgcaaaactgacggggttcgatactttagcccatacgggtaacagtgcatct
agcattgctgatagtttatgtatgctgcaaaagagctaccgatttgacgctcgctcaggc
attggtcagttggcaaaagcggttaattccggttctgctgcgagcgtagataacgtctgg
gcgcgtgacttttctgacatcgaacatttcgcgctaagtagtcagcattacaaccaaatg
atgcagacgttggtgcaggaatacggtcgttacctcaaacgaattggacaacaggaaact
gatcctaaaaccggagagccagagtcgctaacgcacaaagccaaagcggtgttagatacc
ttcaaccaatgccgactgctgtgcgcgatccgtgaaggtgacttcggtgtggctgggcta
aaccaacgcatcgagaaagcgctcgcggcgcgcaagttaattcaggttcaggatgaaatt
tggtatcacggcagacccgtcatggttacgcgtaatgatcacggtttaggtttgtataac
ggtgatattggtatttgtatgcgagatgacagtgaagaagaaccgcgtttgaaagtcttt
ttcgagttacctgacggcagtgtgaaatcggtcttgccaagccgagtgcctgaacatgaa
acggcttacgccatgaccatccataaatcgcaaggcagtgaatttgattacaccctgatg
attttgccaccagactttagcccgatattaactcgtgagttgatttacacaggcattacc
cgcgcgaaaaagcgtttagctctttacgccgaactcaatgttctgaagcgaggtattaaa
gtgaaaaccactcgtgcgagtggattagtacagcggcttactaactaa

DBGET integrated database retrieval system