KEGG   Vibrio sp. Ex25: VEA_002752Help
Entry
VEA_002752        CDS       T01107                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
vex  Vibrio sp. Ex25
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:vex00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    VEA_002752
Enzymes [BR:vex01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     VEA_002752
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1278951..1280156
Genome map
AA seq 401 aa AA seqDB search
MQKLTILGATGSIGASTLKVVEQNPELFSVVALAASTNVEKMIGLCRQWQPKYAVMADKA
AAIQLQSELHLVSPNTEVLGGVDALCHISSLDEVDSVMAAIVGAAGLLPTMAAVKAGKRV
LLANKEALVMSGQLFIDAVEEFGAELLPVDSEHNAIFQCLPQQVQTNLGRCNLQEHGISH
ILLTGSGGPFRYTDIAELEKVTPEQAIAHPNWSMGPKISVDSATMMNKGLEYIEAKWLFN
AAREQLKVIIHPQSVIHSMVQYRDGSVLAQMGEPDMATPIALTMSYPSRVEAGVKPLDFT
QIGELTFLQPDFARYPCLKLAIDACYEGQHATTALNAANEVAVDAFLNNSLGFTDIARIN
ESVLNKINASCKAENANSLESLLELDRMARTIALETIRERS
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaagttaacgattcttggtgctactggatccattggtgcaagcacgcttaaagtg
gtcgaacaaaacccagagctgttttctgtcgttgccttagcggcaagcaccaacgttgaa
aagatgatcgggctatgtcgtcagtggcaacctaaatacgcggtaatggcggacaaagcc
gcagcgattcaactccaatctgagttacatttggtttcgccaaacaccgaagtattaggt
ggtgtggatgctctatgccatatttcttcattggacgaagttgacagtgtgatggctgct
attgtcggagcggctggtctactgcctaccatggctgctgtgaaagctggtaagcgagta
ttgttggcaaataaagaagcgctggtaatgtcaggacagttatttattgatgccgtagaa
gagtttggtgcggagctacttcccgtcgatagtgaacacaatgctattttccagtgctta
ccacagcaagtacaaaccaatttaggtcgttgtaatttacaagaacatggcatttctcat
attttgctgactggttctggtggtcctttccgttacactgacatcgcagaactggaaaag
gtgactcctgagcaggcgatcgcccatccaaactggtcgatgggaccaaagatttccgtt
gactcagccacgatgatgaacaaaggcttagagtatatcgaagctaaatggttgtttaat
gcggctcgcgagcagctaaaggttattattcatccgcagtctgttattcattcaatggtt
caataccgcgatggttcggttttggcacaaatgggtgagccggatatggcgacccctatt
gcactgactatgtcatacccatcaagagttgaagctggggttaagccactagacttcacg
caaattggcgaattgacgtttttgcaacctgattttgctcgttacccatgtttaaaacta
gcaattgatgcttgttatgaaggtcaacatgcaacaacggcactgaatgcagcgaatgaa
gtcgctgttgatgcatttttaaataacagcctaggttttacggatatcgctcgcatcaat
gagtctgtgttgaataaaatcaatgcaagctgcaaagctgagaatgcgaatagcttggaa
agcttgttagagctagatagaatggcacgaactattgccctagaaaccatacgcgagcgt
agctga

DBGET integrated database retrieval system