KEGG   Vibrio sp. Ex25: VEA_002836Help
Entry
VEA_002836        CDS       T01107                                 

Definition
chemotaxis protein CheB (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
vex  Vibrio sp. Ex25
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:vex02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:vex02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1365423..1366535
Genome map
AA seq 370 aa AA seqDB search
MAIKVLVVDDSSFFRRRVSEIINSESRLEVIDVAVNGREAVEKAKSLKPDVITMDIEMPV
MDGITAVREIMAAAPTPILMFSSLTHDGAKATLDALDAGALDFLPKKFEDIARNREEAVS
LLQQRVIQIASKRAFMRRPITRVAASTNAASRPLGSRTASPATPAPARPAAAKFRASGKK
YQLTAIGTSTGGPVALQKILTRLPMNYPHPIVLIQHMPATFTAAFASRLNTLCKIQVKEA
QDGDVLQPGVAYLAPGGKQMMVDGRAGAARLRIIDGGDRMNYKPCVDVTFGSAAKVYGDK
VLSLVLTGMGADGREGARMLKSAGSTIWAQDEESCVVYGMPQAVAKAGISSEDLPLDRIA
ERMLVEVGLA
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atggcgattaaagtactagtcgttgatgattcgagtttttttcgacgtcgcgtgagcgaa
atcatcaactcagaatcgcgcctagaagtgattgacgttgcggtaaatggcagagaggcg
gttgagaaagccaaatctcttaaaccggacgtcatcacgatggatattgaaatgccagtg
atggatggcattaccgctgtacgtgaaatcatggcagcggctccaacgccaatcctaatg
ttttcgtccctgactcatgacggggcgaaagccacgcttgatgcgcttgatgcgggcgca
ttggatttcttaccgaaaaagtttgaagacatcgcacgtaaccgcgaagaagcggtgtca
ctgcttcagcaacgagttattcagattgcttcgaagcgcgcttttatgcgtcgaccaatc
actcgcgttgctgcgagtaccaatgcggcatctcgtccactaggttcaagaacggcttcg
ccagcgactccagctccagctcgaccggctgcggcaaagttccgagcctccggtaagaag
tatcaactgaccgcaattggcacgtcgactggtggtccggttgctttgcaaaaaattctg
acgcgtttaccgatgaactacccgcatccgatcgtattgatccaacatatgccagcaacc
tttactgctgcatttgccagccgtttgaataccttgtgtaagattcaagtgaaagaagcc
caagacggcgatgtcttacagcctggtgtggcataccttgctccaggtggtaagcaaatg
atggtggatggtcgagcgggggctgctcgtcttcgtatcattgatggcggcgaccgcatg
aactacaaaccatgtgtggatgtgacttttggttctgcagccaaagtatacggtgacaaa
gtactctctttagtgctgactggcatgggtgcagacggtcgtgaaggcgctcgtatgttg
aagtctgcaggctcaactatttgggctcaagatgaagaaagttgtgttgtttatggtatg
ccccaagctgttgctaaagcaggcatttcttcagaagatttaccgcttgaccgcattgca
gaacgcatgttggtggaagttggcctagcgtag

DBGET integrated database retrieval system