KEGG   Vibrio sp. Ex25: VEA_002857Help
Entry
VEA_002857        CDS       T01107                                 

Definition
fatty oxidation complex subunit alpha FadJ
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
vex  Vibrio sp. Ex25
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:vex00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VEA_002857
   01212 Fatty acid metabolism
    VEA_002857
  Carbohydrate metabolism
   00640 Propanoate metabolism
    VEA_002857
   00650 Butanoate metabolism
    VEA_002857
  Lipid metabolism
   00071 Fatty acid degradation
    VEA_002857
   01040 Biosynthesis of unsaturated fatty acids
    VEA_002857
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    VEA_002857
   00310 Lysine degradation
    VEA_002857
   00380 Tryptophan metabolism
    VEA_002857
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    VEA_002857
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    VEA_002857
   00281 Geraniol degradation
    VEA_002857
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    VEA_002857
Enzymes [BR:vex01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     VEA_002857
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     VEA_002857
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     VEA_002857
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1384368..1386479
Genome map
AA seq 703 aa AA seqDB search
MSEQKAFSLKVDEQNIAWLAIDVANEKMNTLQAAFADEMKEIFAQLKDASGIKGMIIHSL
KPDNFVAGADVRMLEACTTASEAEALARQGQELFQQLSDLPYPVVAAIHGPCLGGGLELA
LACDYRVCTDSDKTRLGLPEVQLGLLPGSGGTQRLPRLIGLLPSLDLILTGKQLRAKKAK
KLGVVDACVPDTILLDVAKQFIDKGKNKGTKKLSTKEKVMSGSGLGRKFVFEQAAKKTNQ
KTRGNYPATVAILDVIQHGLEKGFAQGQELEAKRFGELVMSSESKALRSIFFATTEMKKE
NGTDAKPAPAHKVGVLGGGLMGAGISHVSVAKAKVPVRIKDVSNDGVLNALNYNYKLFEK
QRKRRILSKADLQAKMLQLSGGVDFTSFNHIDVVIEAVFEDLDLKQKMVADIEANAKPET
IFATNTSSLPIHKIAEKAERPENVVGLHYFSPVEKMPLVEVIPHETTSDETISTVVALAK
KQGKTPIVVKDKAGFYVNRILAPYMNEAAHILLANEPIEKIDTALLDFGFPVGPITLLDE
VGVDIGAKIMPILVNELGERFKGPDVFDILLNDGRKGRKSGKGFYTYKGKKKEVDKSIYK
LLKLDPESKLSDNDIALRCVLPMLNEAVRCLDDGIIRSPRDGDIGAIFGIGFPPFLGGPF
RYMDQFGIKELVEKMNEFASKYGDRYAPCDGLLTRAGEGTTFY
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagcaaaaagcatttagtctaaaagttgatgagcagaatattgcttggttagcg
attgacgtagctaatgaaaaaatgaatacgctacaggcggcttttgctgatgaaatgaaa
gaaatctttgctcagctaaaagacgccagtggcatcaaagggatgatcattcattccctc
aaaccggacaacttcgtcgcgggggccgatgttcgcatgctagaagcgtgcacgaccgca
agtgaagcagaagcattagcgaggcaaggtcaagagctattccagcagctatcggactta
ccatatcctgtggttgccgctattcacggtccatgtttaggcggtggcttagagcttgct
cttgcatgtgattatcgtgtttgtacggattcagataaaacgcgtttaggcctgccagaa
gtacagcttggattgctgccaggttccggcggtacgcagcgtctgccgcgtttgattggc
ctgttaccttcactggacttgatcttaacgggtaaacagcttcgcgcaaagaaagcaaaa
aagctgggtgtggtcgacgcatgcgtacctgatacaattttgctcgatgtagctaaacag
tttatcgacaaaggtaaaaacaagggtacgaaaaagctatccacgaaagaaaaagtgatg
tcgggtagcgggttagggcgcaagtttgtgtttgaacaggcagcgaagaaaaccaaccag
aaaacccgtggtaactatcctgcaacggtcgcgattttagacgttattcagcatggttta
gagaaaggtttcgcccaaggacaagagcttgaagcgaaacgcttcggtgagcttgtgatg
agctctgaatcaaaagcgctccgttctatcttctttgcgacaacggaaatgaagaaagaa
aatggtacggatgcgaaacccgcgccagctcataaagttggcgtgcttggcggtggcttg
atgggcgcaggaatcagccatgtgtctgttgcaaaagcgaaggtgcctgtccgcatcaaa
gacgtcagcaacgatggcgttctaaacgcactcaactataactacaagttattcgagaaa
cagcgtaaacgtcgcattctatcaaaagccgatctgcaagcgaaaatgttgcaactgtct
ggcggtgtcgactttaccagctttaatcatattgatgtcgtaattgaagccgtttttgaa
gacttagatcttaaacaaaaaatggtggcggatattgaagcgaatgccaagccggaaacc
atctttgcgaccaatacttcttcgttaccaatccacaaaattgcagaaaaagcggagcgt
ccagaaaacgtagtgggtttgcattacttcagcccggtagaaaaaatgccgttggtggaa
gtgattccgcatgaaacgacatcagatgaaaccatttcaacagtcgttgcacttgctaaa
aagcaaggtaaaaccccgatcgtagtgaaagacaaagcgggcttttacgtgaaccgcatt
cttgcgccatacatgaacgaagcggcgcatattctgctggctaacgaaccgatcgaaaag
attgatacggcgttgcttgattttggtttccctgtcggcccgattaccttactggatgaa
gtcggtgtcgacattggcgcgaagatcatgccgattctagtcaacgagttaggtgagcga
ttcaaaggccctgacgtgttcgatatcttattgaatgacggtcgcaaaggacgtaagagc
gggaaaggtttctacacttacaaaggtaagaagaaagaagtcgataaatctatctacaag
ctgcttaagctcgatcctgaatctaagctgagcgataacgatattgcgttgcgctgtgta
ctaccaatgctgaatgaagcggtacgttgtttggatgacggcatcattcgctcgccacgt
gatggtgatattggtgcaatatttggcattggtttccctcctttcttgggcggtccattc
cgttatatggatcagtttggcattaaagaactggttgagaaaatgaatgagtttgcatcg
aagtatggcgatcgttacgcaccgtgtgatggtttgcttactcgagctggagaaggaacc
acattctattaa

DBGET integrated database retrieval system