KEGG   Vibrio sp. Ex25: VEA_002887Help
Entry
VEA_002887        CDS       T01107                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
vex  Vibrio sp. Ex25
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:vex00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    VEA_002887
DNA repair and recombination proteins [BR:vex03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      VEA_002887
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1419018..1419536
Genome map
AA seq 172 aa AA seqDB search
MAFHLLQRDRKGGLQLADALSQAMTEIGHCTECRTFTEEEVCHICTNPKRQENGQICVVE
SPADIAAVEATGQYSGRYFVLMGHLSPLDGIGPSDIGLDVLDYRLRRGDIAEVILATNPT
VEGEATAHYIAELCKEHQVDASRIAHGVPVGGELELVDGTTLSHSLLGRHRI
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atggcctttcatttgttacagcgcgatagaaaaggcggtttgcaacttgcagatgcgctt
agccaggcaatgacagaaatcggtcattgtactgagtgtcgaaccttcaccgaagaagaa
gtctgtcatatttgtactaacccaaaacgccaagaaaatggtcaaatttgtgtggtagaa
agcccggcagacattgctgcagtcgaagcaacgggccagtattctggtcgatactttgtt
cttatgggacatttgtcaccactagacggtattggtccaagtgatattggactggatgtg
cttgattaccgcttacgtcgcggtgatatagccgaagtgattttagcaacaaacccgacg
gttgaaggagaagccactgcacattacatcgcagagctatgtaaagaacaccaagttgat
gccagccgcatcgcgcatggtgtgcctgtcggtggagaacttgagcttgtcgatggcacg
acgttgtcacactcgctgttaggtcgacacagaatttaa

DBGET integrated database retrieval system