KEGG   Vibrio sp. Ex25: VEA_002931Help
Entry
VEA_002931        CDS       T01107                                 

Definition
acetaldehyde dehydrogenase (EC:1.1.1.1 1.2.1.10)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
vex  Vibrio sp. Ex25
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:vex00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    VEA_002931
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VEA_002931
   00620 Pyruvate metabolism
    VEA_002931
   00650 Butanoate metabolism
    VEA_002931
  Lipid metabolism
   00071 Fatty acid degradation
    VEA_002931
  Amino acid metabolism
   00350 Tyrosine metabolism
    VEA_002931
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    VEA_002931
   00626 Naphthalene degradation
    VEA_002931
Enzymes [BR:vex01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     VEA_002931
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     VEA_002931
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1471394..1474096
Genome map
AA seq 900 aa AA seqDB search
MPVTNMAELDAMIARVKKAQEEFATYSQEQVDKIFRAASLAANQARIPLAQQAVEESGMG
IVEDKVIKNHFASEFIYNKYKDEQTCGILEEDDNLGTMTIAEPVGIICGIVPTTNPTSTA
IFKSLISLKTRNGIIFSPHPRAKNSTNDAAKLVLDAAVAAGAPKDIIGWIDQPSVELSNA
LMKHDDIALILATGGPGMVKAAYSSGKPAIGVGAGNVPVVIDETADIKRAVASILMSKTF
DNGVVCASEQAAIVVDEVYDEVKERFASHKAYVLSKAEAEKVRKVLLIDGALNAKIVGQP
AAAIAEMAGVKVPADTKVLVGEGLGKVSHDDAFAHEKLSPTLGLFRADNFEDAVAQAVTM
VEIGGIGHTSGLYTNQDTNADRIRYFGDKMKTARILINIPTTHGGIGDLYNFNVAPSLTL
GCGSWGGNSISENVGPKHLINKKTVAKRAENMLWHKLPKSIYFRRGSLPIALGDLEGKKR
AFLVTDRFLFNNGYADDVVSLLKAQGMEVQTFFDVEADPTLSVVEKGAAQMASYQPDVIL
ALGGGSPMDAAKIMWVMYEHPETHFEELAMRFMDIRKRIYKFPKMGQKAELVCITTTSGT
GSEVTPFAVVTDDKTGAKYPLADYEITPNMAIVDANLVMNMPKSLTAFGGYDAVTHALEA
YVSVLANEYSDGQALQALKMLKEYLPSSYANGANDPIAREKVHNAATIAGVAFANAFLGV
CHSMAHKLGAEFHIPHGLANALLISNVVRYNANDNPTKQTAFSQYDRPQARRRYAEVADH
LGLSQAGDRTAQKIERLLAWLDELKVNLDIPMSIQAAGVAEADFIAKLDELAVEAFDDQC
TGANPRYPLISELKDVLMASYYGKAFVEGETFEGTTVIKKKADQEAAKAAPKAKKEKADA
NT seq 2703 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtaactaatatggctgaactagatgcaatgattgctcgcgttaagaaagcgcaa
gaagagttcgctacttactctcaagagcaagtagacaaaatcttccgtgcagcatcgctt
gcagctaaccaagcccgtatcccgctagctcaacaagcggttgaagaatctggtatgggt
attgttgaagataaagtaatcaagaaccacttcgcttctgagtttatctacaacaaatac
aaagacgaacaaacgtgtggcatcctagaagaggatgacaacctaggtactatgactatc
gctgaacctgtaggtatcatctgcggtatcgtaccaacgactaaccctacatctacagcg
atcttcaaatctctaatctctctgaagactcgtaacggtatcatcttctcaccacaccca
cgtgcgaaaaactcgactaacgacgcagcgaaactggttctagacgcagcagtagcagcg
ggtgcaccaaaagacatcatcggttggatcgaccaaccttctgttgagctttctaacgct
cttatgaaacacgatgacatcgcgcttatccttgcaactggtggcccaggcatggttaaa
gcagcttactcttctggtaaaccagcaatcggtgtaggtgcaggtaacgttcctgttgtt
atcgacgaaactgctgacatcaaacgtgcagtggcttctatcctgatgtctaagactttc
gacaacggcgtagtatgtgcttctgagcaggctgcaatcgtcgttgatgaagtgtacgac
gaagtaaaagagcgttttgcttctcacaaagcttacgtactaagcaaagcagaagcagaa
aaagttcgtaaagttcttcttatcgatggcgcgctaaacgcgaaaatcgtaggtcagcca
gcagcggcaatcgctgaaatggcaggcgttaaagttccagcagacacgaaagtccttgtt
ggtgaaggtctaggtaaagtgtctcacgatgacgcattcgctcacgagaaactatctcca
actctaggtctattccgtgctgacaacttcgaagacgcggttgctcaagcggtaactatg
gttgagattggtggtatcggccacacatctggtctttacactaaccaagatactaacgct
gaccgtatccgttacttcggtgacaagatgaagacagctcgtatcctaatcaacatcccg
actactcacggtggtatcggtgacttgtacaacttcaacgttgcgccttctctaactcta
ggttgtggttcatggggtggtaactctatctctgagaacgtaggtcctaaacacctaatc
aacaagaaaactgtagcgaagcgagctgaaaacatgttgtggcataaactacctaagtca
atctacttccgtcgtggtagccttccaattgctctaggcgacctagaaggtaagaagcgc
gcattcttagtaactgaccgtttcctattcaacaatggttacgcagatgacgtagtaagc
ctacttaaagctcaaggcatggaagttcaaacattcttcgatgttgaagctgacccaacg
ctttctgtagtagagaaaggtgcggctcaaatggctagctaccaaccagacgttatccta
gcgctaggtggtggttcaccaatggatgctgcgaagatcatgtgggtaatgtacgagcac
ccagaaactcacttcgaagaactagcaatgcgctttatggacatccgtaaacgtatttac
aagttccctaaaatgggtcaaaaagctgagcttgtatgtatcaccacaacttcaggtact
ggttcagaagttacaccatttgcggttgttactgacgacaagactggtgctaaataccca
ctagctgactacgaaatcacgccaaacatggctatcgttgatgctaacctagtgatgaac
atgcctaagtctctaacagcatttggtggttacgatgcagtaactcacgctctagaagct
tacgtatctgttcttgcgaacgaatactcagatggtcaggctctacaagcacttaagatg
ctaaaagaatacttaccttcaagctacgcgaacggcgctaacgacccaatcgctcgtgag
aaagtacacaacgccgcaactatcgctggtgtggcatttgctaacgcattcctaggtgtt
tgtcactcaatggcgcacaaactaggtgctgagttccacattccacatggcctagcaaac
gcactacttatctctaacgttgtacgttacaacgcgaacgataacccaactaaacaaaca
gcgttctctcaatacgaccgcccacaagcacgtcgtcgttacgctgaagttgctgaccac
ttaggtctaagccaagctggtgaccgtactgctcagaaaattgaacgtctactagcatgg
ttggatgagctaaaagtgaacctagacatcccaatgtctatccaagcggcaggcgtagct
gaagcagactttatcgcgaaacttgatgagctagcagttgaagcgttcgatgaccaatgt
actggtgcgaaccctcgctacccactaattagcgaacttaaagatgtgttaatggcttct
tactacggtaaagcattcgttgaaggtgaaactttcgaaggtacaacagttatcaagaag
aaagcagaccaagaagcagcgaaagcggcgcctaaagcaaagaaagaaaaagctgacgcg
taa

DBGET integrated database retrieval system