KEGG   Vibrio sp. Ex25: VEA_004110Help
Entry
VEA_004110        CDS       T01107                                 

Definition
(RefSeq) succinyl-CoA ligase [ADP-forming] subunit beta (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
vex  Vibrio sp. Ex25
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:vex00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VEA_004110
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    VEA_004110
   00640 Propanoate metabolism
    VEA_004110
   00660 C5-Branched dibasic acid metabolism
    VEA_004110
Enzymes [BR:vex01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     VEA_004110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2774564..2775730)
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKQLFAEFGLPVPEGYACDTPQEAFEAAGRISTEKKVVKCQVHAGGRGKAGGV
ELHDTKEGVKEFAQKWLGKNLVTYQTDANGQPVTKILVEEASNIANELYLGAVVDRASRK
IVFMASTEGGVEIEKVAEETPELIHKAAIDPLVGPQAYQGRELAFKLGLEGDQIKQFVKI
FMGLGTMFAQYDLALLEINPLVVTGEGNLLCLDGKINIDSNALYRQPKLREMHDPSQEDE
REAHAAQWELNYVALDGNVGCMVNGAGLAMGTMDIVNLHGGKPANFLDVGGGATKERVAE
AFKIILSDDNVKAVLVNIFGGIVRCDMIAEGIIGAVKEVGVSVPVVVRLEGTNADLGREV
LANSDVDIIAAESLTDAAQKVVAAAEAK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatttgcatgaataccaagccaaacagctgtttgcagaattcggtttgcctgtgcca
gaaggctacgcgtgtgatacaccacaagaagcttttgaagctgcaggccgtatcagtaca
gaaaagaaagtagttaaatgtcaggttcacgctggtggccgtggtaaagcgggcggtgta
gagctgcacgatacaaaagaaggcgttaaagagtttgcacaaaagtggttaggtaaaaac
ctagtgacttaccaaactgacgctaacggtcagccagttacaaaaatccttgttgaagaa
gcttcaaacattgcaaacgaattatacctaggtgcggttgttgaccgtgcaagccgtaag
atcgttttcatggcttcaacagaaggtggtgtggaaatcgaaaaagttgcggaagaaacg
ccggagcttatccacaaagcagcaatcgatccactagtaggcccacaagcttaccaaggt
cgcgagcttgcgttcaaacttggtcttgaaggcgaccaaatcaaacaattcgttaagatc
ttcatgggtcttggcacgatgttcgcccagtacgatcttgctctacttgagatcaacccg
cttgtggttactggtgaaggcaacctgctatgtcttgatggtaagatcaacatcgattca
aacgctctttaccgtcagcctaagcttcgtgaaatgcacgatccatcacaagaagatgag
cgtgaagcacacgcagctcagtgggaactgaactacgtagcactagacggtaacgttggc
tgtatggttaacggtgctggcctagcaatgggtacgatggatatcgtaaacctacacggc
ggcaaaccagctaacttcctagacgtaggtggcggcgcgacgaaagagcgtgttgctgaa
gcattcaagatcatcctatcagatgacaacgtgaaagcggtacttgttaacatcttcggt
ggtatcgtacgttgtgacatgatcgcagaaggtattatcggtgcggttaaagaagtaggt
gtaagcgtacctgttgttgttcgtctagaaggtactaacgctgacctaggtcgcgaagtt
cttgctaattctgatgttgatatcattgctgctgagtcgctaacggatgctgctcagaaa
gttgttgctgctgcggaggctaaataa

DBGET integrated database retrieval system