KEGG   Vibrio antiquarius: VEA_004115Help
Entry
VEA_004115        CDS       T01107                                 

Definition
(GenBank) succinate dehydrogenase hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
vex  Vibrio antiquarius
Pathway
vex00020  Citrate cycle (TCA cycle)
vex00190  Oxidative phosphorylation
vex00650  Butanoate metabolism
vex01100  Metabolic pathways
vex01110  Biosynthesis of secondary metabolites
vex01120  Microbial metabolism in diverse environments
vex01130  Biosynthesis of antibiotics
vex01200  Carbon metabolism
Module
vex_M00009  Citrate cycle (TCA cycle, Krebs cycle)
vex_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
vex_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:vex00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    VEA_004115
   00650 Butanoate metabolism
    VEA_004115
  Energy metabolism
   00190 Oxidative phosphorylation
    VEA_004115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS Fumarate_red_C
Motif
Other DBs
NCBI-ProteinID: ACY52275
Position
1:complement(2782670..2783014)
Genome map
AA seq 114 aa AA seqDB search
MVKHVSSFGRNGVHDFLLIRATAIIMTLYTIYLISFCAFSDISYASWTQFFGGTFTKVFT
MLALVSILIHAWVGLWQVLTDYIKCAKLRGALQLGVIAVLFGYVFSGLFILWGA
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaacacgtatcttcatttggtcgtaatggtgtacacgatttcctactgattcgt
gcaactgcaatcattatgacgctatacacgatttatctgattagcttctgtgcattttca
gatatctcttacgcatcttggacccaattctttggtggtaccttcactaaagtattcacc
atgttggcacttgtctcgatcctgatccacgcatgggtcggtttatggcaggtattaacg
gattacattaagtgcgcgaaacttcgtggcgcactgcaacttggtgttattgccgtgcta
ttcggctatgtcttctctggtctatttattctgtggggtgcgtaa

DBGET integrated database retrieval system