KEGG   Vibrio sp. Ex25: VEA_004115Help
Entry
VEA_004115        CDS       T01107                                 

Definition
(RefSeq) succinate dehydrogenase hydrophobic membrane anchor protein
  KO
K00242  
succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
vex  Vibrio sp. Ex25
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:vex00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VEA_004115
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    VEA_004115
   00650 Butanoate metabolism
    VEA_004115
  Energy metabolism
   00190 Oxidative phosphorylation
    VEA_004115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2782670..2783014)
Genome map
AA seq 114 aa AA seqDB search
MVKHVSSFGRNGVHDFLLIRATAIIMTLYTIYLISFCAFSDISYASWTQFFGGTFTKVFT
MLALVSILIHAWVGLWQVLTDYIKCAKLRGALQLGVIAVLFGYVFSGLFILWGA
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaacacgtatcttcatttggtcgtaatggtgtacacgatttcctactgattcgt
gcaactgcaatcattatgacgctatacacgatttatctgattagcttctgtgcattttca
gatatctcttacgcatcttggacccaattctttggtggtaccttcactaaagtattcacc
atgttggcacttgtctcgatcctgatccacgcatgggtcggtttatggcaggtattaacg
gattacattaagtgcgcgaaacttcgtggcgcactgcaacttggtgttattgccgtgcta
ttcggctatgtcttctctggtctatttattctgtggggtgcgtaa

DBGET integrated database retrieval system