KEGG   Vibrio sp. Ex25: VEA_004132Help
Entry
VEA_004132        CDS       T01107                                 

Definition
asparagine synthetase (glutamine-hydrolyzing) (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
vex  Vibrio sp. Ex25
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vex00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    VEA_004132
Enzymes [BR:vex01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     VEA_004132
Peptidases [BR:vex01002]
 Cysteine Peptidases
  Family C44
   VEA_004132
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2800779..2802443
Genome map
AA seq 554 aa AA seqDB search
MCSVFGILDIKSDAAALRPIALEMSKKLRHRGPDWSGIYSSERAILAHERLAIVGLNSGA
QPLYSPDKKLILAVNGEIYNHKEIRARYEGKYEFQTDSDCEVILALYQDMGADLLEELNG
IFAFVLYDEEKDEYLVGRDHIGIIPLYQGHDEHGNYYVASEMKALVPVCKTVSEFPPGSY
YSSKDAEPTRYYVRDWNEYAAVQGNTTSKEELTEALEAAVKRQLMTDVPYGVLLSGGLDS
SITSAVAKRFAAMRIEDDEKSEAWWPQLHSFAVGLEGAPDLKAAREVADQIGTVHHEMTY
TIQEGLDAIRDVIYHIETYDVTTIRASTPMFLMGRKIKAMGIKMVLSGEGADEIFGGYLY
FHKAPNAKEFHEETVRKLLALNMFDCARANKSLAAWGVEGRVPFLDKEFIDVAMRLNPAD
KMCGNGKMEKHILRECFEHYLPESIAWRQKEQFSDGVGYSWIDTLKEVAEQKVTDQQMET
AQYRFPYNTPTTKEGYVYREIFEELFPLPSAAECVPGGPSVACSSAKAIEWDESFQNCVD
PSGRAVQTVHNDAY
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgtgttcagtatttggcattttagacattaaaagcgatgcagccgcattgcgccctatc
gcattagaaatgtcgaaaaaacttcgtcatcgtggccctgactggtctgggatttactct
tcagagcgcgctattttagcgcatgagcgcttggcgattgttggcctaaatagtggtgca
caaccgctatacagccctgataaaaagctcatccttgcagtcaatggtgaaatctacaac
cataaagaaattcgtgctcgttacgaaggaaaatacgagtttcaaaccgattcagactgt
gaagtcattcttgcactgtaccaagatatgggtgcagatctccttgaagaactaaacggt
attttcgcttttgttctgtacgatgaagaaaaagacgaatacttagtcggtcgcgatcac
attggcattatccctctttatcaaggtcatgatgagcatggcaactactatgttgcatca
gagatgaaggcacttgttccagtatgtaaaacagtgagcgagttccctcctggtagctac
tacagttcaaaagatgccgagccaacgcgttactatgttcgtgactggaacgaatacgct
gccgttcaaggtaacaccaccagcaaagaagaactgactgaagcactagaagcagcggtt
aaacgccaactaatgacggatgttccatatggtgttttactatcaggtggtttagattca
tccatcacctctgctgtggctaaacgttttgctgcaatgcgaattgaagacgatgaaaag
tctgaagcttggtggccacaactgcactcttttgctgtgggcctagaaggcgcgcctgac
ctgaaagccgctcgcgaagttgccgaccaaatcggtaccgttcaccatgaaatgacttat
acaattcaagaaggtctcgacgcgattcgcgacgtgatttaccacatcgaaacgtacgat
gtgaccaccatccgcgcatccacacctatgttcttaatgggtcgtaagatcaaagcgatg
ggcattaagatggtactttctggtgaaggtgcagatgagatctttggtggttacctatat
ttccacaaagcaccaaacgcgaaagagttccacgaagaaacggtacgtaagctgcttgct
ctgaacatgtttgactgcgctcgcgcaaacaaatcgctagcggcatggggggttgaaggc
cgagtaccgttccttgataaagagtttatcgacgttgcaatgcgcctaaacccagcagat
aagatgtgtggcaacggcaaaatggaaaaacacattctacgcgagtgttttgagcattac
ttgccagagtcgatcgcatggcgtcaaaaagaacagttctctgatggcgtaggttacagc
tggattgatacgttgaaagaagtcgcagagcaaaaagtgacggatcagcagatggaaacg
gctcaataccgcttcccatacaacacgccaaccacaaaagaaggttacgtgtaccgagaa
atctttgaagagctgttcccactaccttcagcggctgagtgtgtgccaggtggtccttca
gtagcttgttcatcagcgaaagcgattgaatgggatgagtcattccaaaactgtgtagac
ccgtcaggtcgtgcggtgcaaaccgtccataacgacgcttactaa

DBGET integrated database retrieval system