KEGG   Vibrio sp. Ex25: VEA_004372Help
Entry
VEA_004372        CDS       T01107                                 

Definition
(RefSeq) malate synthase (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
vex  Vibrio sp. Ex25
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:vex00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VEA_004372
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    VEA_004372
   00630 Glyoxylate and dicarboxylate metabolism
    VEA_004372
Enzymes [BR:vex01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     VEA_004372
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(3065812..3067440)
Genome map
AA seq 542 aa AA seqDB search
MLAQTEQKTQQLKQTQGMLEVNGVVAPEHQAIFPVEAQTFLSLLCEKFAGRVEQLLEARE
EKQARIDAGELPDFLPETQDIREGSWKILGIPQDLQDRRVEITGPTDRKMVINALNANVK
VFMADFEDSMSPAWSKVLDGQVNLRDAVNGTISYINPGNGKHYQLEDDPAVLICRVRGLH
LKEKHVTWHGQIIPGALFDFALYFYNNYKALLQKGSGPYFYIPKLQSHHEAKWWSEVFHF
TEDYFGLDTGTIKATVLIETLPAVFEMDEILFSLKEHIVGLNCGRWDYIFSYIKTLKKHP
ERVLPDRQVVTMDKPFLNAYSRLLVRTCHKRGAFAMGGMAAFIPAKNPQENQKVLDKIQT
DKSLEANNGHDGTWVAHPGLADTAMEVFSAVLGERTNQLDVSRSEDAPITAAELLEPCEG
ERTEAGMRHNIRVALQYIEAWISGNGCVPIYGLMEDAATAEISRASIWQWIQHGKSLDNG
LKVTKDLFELYLKEEIEVVKQEIGEQRYQAGRFEEAADLMARLTTSDELTNFLTVPGYDY
LD
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgcttgctcagacagaacaaaaaacacaacaactaaagcaaacccaaggcatgcttgag
gtgaatggagtcgttgctccagaacatcaagcaattttccctgttgaagcccaaaccttt
ttatctctactgtgtgaaaaatttgccggacgtgttgagcagttgctggaagcacgagaa
gagaagcaagcgcgtatcgatgcaggtgagctgccagactttttaccagagacacaagac
atccgtgaaggaagctggaagatcctgggaatcccacaagatctgcaagatcgccgtgtg
gagattaccggaccaactgatcgcaagatggtgattaacgcactgaatgcgaatgtaaaa
gtgtttatggcagacttcgaagattcaatgtctccagcatggagtaaagtgctggatggg
caagtgaatttacgcgatgccgtgaatggcaccatcagttacatcaaccctggcaatggc
aagcattatcagctggaagatgacccagcggtgttgatctgccgtgttcgcggccttcat
ttaaaagaaaaacacgttacgtggcacggtcagatcattccaggtgcgctattcgatttc
gctctgtacttctataacaactacaaagcgttacttcaaaaaggcagcggcccttatttc
tacattccaaaactgcaatcgcatcacgaagcgaagtggtggagcgaagtgttccatttc
acggaagactatttcggtcttgatacaggcaccatcaaagcgacagtgctgattgaaacc
ttaccagccgtattcgaaatggatgagattctgttctcacttaaagaacacatcgttggt
ttgaactgtggtcgctgggattacatctttagctacatcaaaaccttgaagaagcaccct
gaacgcgtactgccagatcgccaagtggttacgatggataagccattcttgaacgcttac
tcgcgattattggtgcgtacttgtcataaacgaggtgctttcgcgatgggaggaatggcc
gcctttatcccagcgaaaaacccgcaagagaatcaaaaagtattagacaagatccagact
gacaaatcgctagaagcaaacaacggtcacgacggtacttgggtagctcatccaggtttg
gctgacaccgcgatggaagtttttagtgctgtactgggcgagcgcaccaatcaattggat
gtgagtcgttcagaggatgcacctattacagcggctgaactacttgagccttgtgaaggc
gagcgtacagaagccggaatgcgccacaatattcgtgttgcgctgcaatacatcgaagct
tggatttctggtaatggttgtgtaccaatttatggcttgatggaagatgcggcgacagct
gaaatctctcgcgcttctatctggcaatggattcaacacggcaagtcgctagataacgga
ttgaaggtcactaaggatctgttcgagctctatctaaaagaagagattgaagtcgtgaaa
caagaaattggtgagcagcgctaccaagcgggtcgatttgaagaagcggcagacttgatg
gcaagactcaccacaagcgatgagctgaccaactttttaacagttcctggttatgactac
ctggattaa

DBGET integrated database retrieval system