KEGG   Vibrio sp. Ex25: VEA_004440Help
Entry
VEA_004440        CDS       T01107                                 

Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
vex  Vibrio sp. Ex25
Brite
Enzymes [BR:vex01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     VEA_004440
Secretion system [BR:vex02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   VEA_004440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(3150169..3150957)
Genome map
AA seq 262 aa AA seqDB search
MSVLRRLTLLTLPFFVTACGAEESQAKTDTPAQQVAPAAQSSFDEAALKTKFSKLGLSIV
DIQPSEVAGLLEIQTNGGILFASNDGSHFIAGTLYAINDDGSYKDVIAERQAPLNAEKIA
QFSDSMIEYKADDEKYAVTVFTDITCGYCVRLHSQMQGYNDLGITVRYMAYPRQGATGPV
AEQMATIWCAEDPKSAMHNAKVNRTFDNPAKDLKQCKETIQSHYNLGRQLGISGTPAIFL
PNGEMVGGYLPPAELLKRLKQQ
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtattacgccgactaactctgctgactttaccattttttgttaccgcgtgtggt
gcagaagaaagtcaggctaaaacggacactcctgcacagcaagtggcaccagctgcgcaa
agcagttttgatgaagcagcattaaaaactaagttctcaaagcttggtttatctatcgtt
gatattcagccatcagaagttgctggtttattggaaatccaaactaatggcgggatcttg
tttgcttcaaatgatggtagccattttatcgccggtacgctttatgccatcaatgacgat
ggtagttacaaagatgtcattgcagagcgccaagcgccgcttaatgcggagaaaatcgcg
cagttctccgatagcatgattgaatacaaagccgacgatgaaaaatatgcagtgacggta
tttactgatatcacttgtggttactgtgtgcgtctgcacagccaaatgcaaggctataac
gatctaggcattacagtgcgttacatggcttaccctcgccaaggtgctactggcccagtg
gcagagcaaatggcgacgatttggtgtgctgaagatccaaagtcggcaatgcacaacgcg
aaagtgaatcgtacgtttgataaccctgcgaaagacttaaaacagtgtaaagaaaccatc
caatcacattacaatctaggtcgccaattgggaatttctggtacgccagcgatcttctta
ccgaatggcgaaatggttggcggttacctaccacctgcagagctattgaaacgtttaaag
caacaataa

DBGET integrated database retrieval system