KEGG   Vibrio sp. Ex25: VEA_004455Help
Entry
VEA_004455        CDS       T01107                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
vex  Vibrio sp. Ex25
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:vex00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    VEA_004455
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    VEA_004455
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    VEA_004455
Enzymes [BR:vex01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     VEA_004455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(3164048..3165328)
Genome map
AA seq 426 aa AA seqDB search
MKLYNIKENDEQVSFGQAVRQGLGRNQGLFFPSELPKFEDVDALLAEDFVSRSTKILSAF
IGDELAEEQVNALVDAAFQFPAPINQVKDGVYALELFHGPTLAFKDFGGRFMAQSLAAVS
DGGKITILTATSGDTGAAVAHAFYGMEDINVVILYPKGKISPLQEKLFCTLGKNIHTVAI
DGDFDACQALVKQAFDDSALREEIGLNSANSINISRLMAQICYYFEAAAQMSKQERENLV
VSVPSGNFGNLTAGLLAKALGLPIKRFIAATNANDTVPRYLETGKWEPKPTVATTSNAMD
VSQPNNWPRIEELCRVKEWGLETLGKGAVSDEQSAQSVKDLYSLGYLCEPHGAIAYRVLE
EQLQDGETGLFLCTAHPAKFKEVVDDILQSDIELPAPLAKHAAMELLSEELDADFDALKQ
VLRRVQ
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgaagctttacaatataaaagaaaatgatgaacaagtttcctttggccaagccgttcgc
caagggttaggccgtaaccaaggtctatttttcccatcggaattaccaaagtttgaagac
gttgatgcgctactggcagaagactttgtttctcgtagcactaagattttatcagcgttt
atcggtgatgagctggcggaagagcaagtcaacgcgcttgtggacgcagcgttccaattc
ccggcgccaatcaatcaagtcaaagacggtgtttacgcgttagagcttttccatggtcca
acgctggcatttaaagattttggcggtcgctttatggcgcaatctcttgcggcggtatcg
gacggtggcaagatcaccattctgactgcgacttctggcgatactggcgcagccgttgcg
cacgctttctatggtatggaagacatcaacgttgtgattctttacccgaaaggcaagatc
agcccactgcaagagaagctattctgtacgctaggcaagaacattcacactgtcgcgatc
gatggcgacttcgatgcgtgccaggctctggttaagcaagctttcgatgattccgcactg
cgtgaagagatcggcctgaactctgcaaactcaatcaacatcagccgtttgatggcgcaa
atctgttactactttgaagcagcagcgcaaatgagcaaacaagagcgtgaaaacctagtc
gtgtctgtaccaagtggtaactttggtaacctaactgctggtctactggcaaaagcgctg
ggtctgccgatcaaacgctttatcgctgcaactaacgctaatgacacggttccgcgctac
ctagaaacaggtaagtgggagccaaaaccaacggttgcaacgacatcgaacgcgatggac
gtgagtcaaccgaacaactggccgcgtatcgaagagctctgccgagtgaaagagtggggc
ctagagactctaggtaaaggcgcggtttcagatgagcaaagcgcacaatctgtgaaagac
ctgtactcattgggctacctatgtgaaccgcacggtgcgattgcttaccgcgttcttgaa
gagcaactgcaagatggtgaaaccggtctgttcctatgtactgcgcacccagcgaagttc
aaagaagtggtggatgacattttgcaatctgacatcgagcttcctgcaccgctagcgaag
cacgcggcaatggaactgctatcggaagagctagacgcagactttgatgcattgaaacaa
gtactgcgccgcgtacagtaa

DBGET integrated database retrieval system